KEGG   Homo sapiens (human): 101Help
Entry
101               CDS       T01001                                 

Gene name
ADAM8, CD156, CD156a, MS2
Definition
(RefSeq) ADAM metallopeptidase domain 8
  KO
K06540  disintegrin and metalloproteinase domain-containing protein 8 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    101 (ADAM8)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    101 (ADAM8)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     101 (ADAM8)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   101 (ADAM8)
CD molecules [BR:hsa04090]
 Proteins
  101 (ADAM8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Reprolysin Pep_M12B_propep Reprolysin_5 Disintegrin Reprolysin_3 Reprolysin_2 Reprolysin_4 ADAM_CR EGF_2 ADAM_CR_2 Peptidase_M10 Peptidase_M66
Motif
Other DBs
NCBI-GeneID: 101
NCBI-ProteinID: NP_001100
OMIM: 602267
HGNC: 215
Ensembl: ENSG00000151651
Vega: OTTHUMG00000019309
Pharos: P78325(Tchem)
UniProt: P78325 Q14C66
Structure
PDB: 

Position
10q26.3
AA seq 824 aa AA seqDB search
MRGLGLWLLGAMMLPAIAPSRPWALMEQYEVVLPWRLPGPRVRRALPSHLGLHPERVSYV
LGATGHNFTLHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHVEGYPDSAAS
LSTCAGLRGFFQVGSDLHLIEPLDEGGEGGRHAVYQAEHLLQTAGTCGVSDDSLGSLLGP
RTAAVFRPRPGDSLPSRETRYVELYVVVDNAEFQMLGSEAAVRHRVLEVVNHVDKLYQKL
NFRVVLVGLEIWNSQDRFHVSPDPSVTLENLLTWQARQRTRRHLHDNVQLITGVDFTGTT
VGFARVSAMCSHSSGAVNQDHSKNPVGVACTMAHEMGHNLGMDHDENVQGCRCQERFEAG
RCIMAGSIGSSFPRMFSDCSQAYLESFLERPQSVCLANAPDLSHLVGGPVCGNLFVERGE
QCDCGPPEDCRNRCCNSTTCQLAEGAQCAHGTCCQECKVKPAGELCRPKKDMCDLEEFCD
GRHPECPEDAFQENGTPCSGGYCYNGACPTLAQQCQAFWGPGGQAAEESCFSYDILPGCK
ASRYRADMCGVLQCKGGQQPLGRAICIVDVCHALTTEDGTAYEPVPEGTRCGPEKVCWKG
RCQDLHVYRSSNCSAQCHNHGVCNHKQECHCHAGWAPPHCAKLLTEVHAASGSLPVFVVV
VLVLLAVVLVTLAGIIVYRKARSRILSRNVAPKTTMGRSNPLFHQAASRVPAKGGAPAPS
RGPQELVPTTHPGQPARHPASSVALKRPPPAPPVTVSSPPFPVPVYTRQAPKQVIKPTFA
PPVPPVKPGAGAANPGPAEGAVGPKVALKPPIQRKQGAGAPTAP
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcctcgggctctggctgctgggcgcgatgatgctgcctgcgattgcccccagc
cggccctgggccctcatggagcagtatgaggtcgtgttgccgtggcgtctgccaggcccc
cgagtccgccgagctctgccctcccacttgggcctgcacccagagagggtgagctacgtc
cttggggccacagggcacaacttcaccctccacctgcggaagaacagggacctgctgggc
tccggctacacagagacctatacggctgccaatggctccgaggtgacggagcagcctcgc
gggcaggaccactgcttctaccagggccacgtagaggggtacccggactcagccgccagc
ctcagcacctgtgccggcctcaggggtttcttccaggtggggtcagacctgcacctgatc
gagcccctggatgaaggtggcgagggcggacggcacgccgtgtaccaggctgagcacctg
ctgcagacggccgggacctgcggggtcagcgacgacagcctgggcagcctcctgggaccc
cggacggcagccgtcttcaggcctcggcccggggactctctgccatcccgagagacccgc
tacgtggagctgtatgtggtcgtggacaatgcagagttccagatgctggggagcgaagca
gccgtgcgtcatcgggtgctggaggtggtgaatcacgtggacaagctatatcagaaactc
aacttccgtgtggtcctggtgggcctggagatttggaatagtcaggacaggttccacgtc
agccccgaccccagtgtcacactggagaacctcctgacctggcaggcacggcaacggaca
cggcggcacctgcatgacaacgtacagctcatcacgggtgtcgacttcaccgggactacc
gtggggtttgccagggtgtccgccatgtgctcccacagctcaggggctgtgaaccaggac
cacagcaagaaccccgtgggcgtggcctgtaccatggcccatgagatgggccacaacctg
ggcatggaccatgatgagaacgtccagggctgccgctgccaggaacgcttcgaggccggc
cgctgcatcatggcgggcagcattggctccagtttccccaggatgttcagtgactgcagc
caggcctacctggagagctttttggagcggccgcagtcggtgtgcctcgccaacgcccct
gacctcagccacctggtgggcggccccgtgtgtgggaacctgtttgtggagcgtggggag
cagtgcgactgcggcccccccgaggactgccggaaccgctgctgcaactctaccacctgc
cagctggctgagggggcccagtgtgcgcacggtacctgctgccaggagtgcaaggtgaag
ccggctggtgagctgtgccgtcccaagaaggacatgtgtgacctcgaggagttctgtgac
ggccggcaccctgagtgcccggaagacgccttccaggagaacggcacgccctgctccggg
ggctactgctacaacggggcctgtcccacactggcccagcagtgccaggccttctggggg
ccaggtgggcaggctgccgaggagtcctgcttctcctatgacatcctaccaggctgcaag
gccagccggtacagggctgacatgtgtggcgttctgcagtgcaagggtgggcagcagccc
ctggggcgtgccatctgcatcgtggatgtgtgccacgcgctcaccacagaggatggcact
gcgtatgaaccagtgcccgagggcacccggtgtggaccagagaaggtttgctggaaagga
cgttgccaggacttacacgtttacagatccagcaactgctctgcccagtgccacaaccat
ggggtgtgcaaccacaagcaggagtgccactgccacgcgggctgggccccgccccactgc
gcgaagctgctgactgaggtgcacgcagcgtccgggagcctccccgtcttcgtggtggtg
gttctggtgctcctggcagttgtgctggtcaccctggcaggcatcatcgtctaccgcaaa
gcccggagccgcatcctgagcaggaacgtggctcccaagaccacaatggggcgctccaac
cccctgttccaccaggctgccagccgcgtgccggccaagggcggggctccagccccatcc
aggggcccccaagagctggtccccaccacccacccgggccagcccgcccgacacccggcc
tcctcggtggctctgaagaggccgccccctgctcctccggtcactgtgtccagcccaccc
ttcccagttcctgtctacacccggcaggcaccaaagcaggtcatcaagccaacgttcgca
cccccagtgcccccagtcaaacccggggctggtgcggccaaccctggtccagctgagggt
gctgttggcccaaaggttgccctgaagccccccatccagaggaagcaaggagccggagct
cccacagcaccctag

DBGET integrated database retrieval system