KEGG   Homo sapiens (human): 102Help
Entry
102               CDS       T01001                                 

Gene name
ADAM10, AD10, AD18, CD156c, CDw156, HsT18717, MADM, RAK, kuz
Definition
(RefSeq) ADAM metallopeptidase domain 10
  KO
K06704  disintegrin and metalloproteinase domain-containing protein 10 [EC:3.4.24.81]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
Drug target
Aderbasib: D09320
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    102 (ADAM10)
  09167 Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    102 (ADAM10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    102 (ADAM10)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:hsa04090]
    102 (ADAM10)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.81  ADAM10 endopeptidase
     102 (ADAM10)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   102 (ADAM10)
CD molecules [BR:hsa04090]
 Proteins
  102 (ADAM10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Reprolysin_2 Reprolysin_5 Reprolysin_3 Reprolysin_4 Disintegrin Pep_M12B_propep Reprolysin Peptidase_M66
Motif
Other DBs
NCBI-GeneID: 102
NCBI-ProteinID: NP_001101
OMIM: 602192
HGNC: 188
Ensembl: ENSG00000137845
Vega: OTTHUMG00000132633
Pharos: O14672(Tchem)
UniProt: O14672 A0A024R5U5
Structure
PDB: 

Position
15q21.3
AA seq 748 aa AA seqDB search
MVLLRVLILLLSWAAGMGGQYGNPLNKYIRHYEGLSYNVDSLHQKHQRAKRAVSHEDQFL
RLDFHAHGRHFNLRMKRDTSLFSDEFKVETSNKVLDYDTSHIYTGHIYGEEGSFSHGSVI
DGRFEGFIQTRGGTFYVEPAERYIKDRTLPFHSVIYHEDDINYPHKYGPQGGCADHSVFE
RMRKYQMTGVEEVTQIPQEEHAANGPELLRKKRTTSAEKNTCQLYIQTDHLFFKYYGTRE
AVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTADEKDPTNPFRFPNIGVEKF
LELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLNT
GIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYAR
ATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCK
DECCFDANQPEGRKCKLKPGKQCSPSQGPCCTAQCAFKSKSEKCRDDSDCAREGICNGFT
ALCPASDPKPNFTDCNRHTQVCINGQCAGSICEKYGLEECTCASSDGKDDKELCHVCCMK
KMDPSTCASTGSVQWSRHFSGRTITLQPGSPCNDFRGYCDVFMRCRLVDADGPLARLKKA
IFSPELYENIAEWIVAHWWAVLLMGIALIMLMAGFIKICSVHTPSSNPKLPPPKPLPGTL
KRRRPPQPIQQPQRQRPRESYQMGHMRR
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgctgagagtgttaattctgctcctctcctgggcggcggggatgggaggtcag
tatgggaatcctttaaataaatatatcagacattatgaaggattatcttacaatgtggat
tcattacaccaaaaacaccagcgtgccaaaagagcagtctcacatgaagaccaattttta
cgtctagatttccatgcccatggaagacatttcaacctacgaatgaagagggacacttcc
cttttcagtgatgaatttaaagtagaaacatcaaataaagtacttgattatgatacctct
catatttacactggacatatttatggtgaagaaggaagttttagccatgggtctgttatt
gatggaagatttgaaggattcatccagactcgtggtggcacattttatgttgagccagca
gagagatatattaaagaccgaactctgccatttcactctgtcatttatcatgaagatgat
attaactatccccataaatacggtcctcaggggggctgtgcagatcattcagtatttgaa
agaatgaggaaataccagatgactggtgtagaggaagtaacacagatacctcaagaagaa
catgctgctaatggtccagaacttctgaggaaaaaacgtacaacttcagctgaaaaaaat
acttgtcagctttatattcagactgatcatttgttctttaaatattacggaacacgagaa
gctgtgattgcccagatatccagtcatgttaaagcgattgatacaatttaccagaccaca
gacttctccggaatccgtaacatcagtttcatggtgaaacgcataagaatcaatacaact
gctgatgagaaggaccctacaaatcctttccgtttcccaaatattggtgtggagaagttt
ctggaattgaattctgagcagaatcatgatgactactgtttggcctatgtcttcacagac
cgagattttgatgatggcgtacttggtctggcttgggttggagcaccttcaggaagctct
ggaggaatatgtgaaaaaagtaaactctattcagatggtaagaagaagtccttaaacact
ggaattattactgttcagaactatgggtctcatgtacctcccaaagtctctcacattact
tttgctcacgaagttggacataactttggatccccacatgattctggaacagagtgcaca
ccaggagaatctaagaatttgggtcaaaaagaaaatggcaattacatcatgtatgcaaga
gcaacatctggggacaaacttaacaacaataaattctcactctgtagtattagaaatata
agccaagttcttgagaagaagagaaacaactgttttgttgaatctggccaacctatttgt
ggaaatggaatggtagaacaaggtgaagaatgtgattgtggctatagtgaccagtgtaaa
gatgaatgctgcttcgatgcaaatcaaccagagggaagaaaatgcaaactgaaacctggg
aaacagtgcagtccaagtcaaggtccttgttgtacagcacagtgtgcattcaagtcaaag
tctgagaagtgtcgggatgattcagactgtgcaagggaaggaatatgtaatggcttcaca
gctctctgcccagcatctgaccctaaaccaaacttcacagactgtaataggcatacacaa
gtgtgcattaatgggcaatgtgcaggttctatctgtgagaaatatggcttagaggagtgt
acgtgtgccagttctgatggcaaagatgataaagaattatgccatgtatgctgtatgaag
aaaatggacccatcaacttgtgccagtacagggtctgtgcagtggagtaggcacttcagt
ggtcgaaccatcaccctgcaacctggatccccttgcaacgattttagaggttactgtgat
gttttcatgcggtgcagattagtagatgctgatggtcctctagctaggcttaaaaaagca
atttttagtccagagctctatgaaaacattgctgaatggattgtggctcattggtgggca
gtattacttatgggaattgctctgatcatgctaatggctggatttattaagatatgcagt
gttcatactccaagtagtaatccaaagttgcctcctcctaaaccacttccaggcacttta
aagaggaggagacctccacagcccattcagcaaccccagcgtcagcggccccgagagagt
tatcaaatgggacacatgagacgctaa

DBGET integrated database retrieval system