KEGG   Homo sapiens (human): 10392Help
Entry
10392             CDS       T01001                                 

Gene name
NOD1, CARD4, CLR7.1, NLRC1
Definition
(RefSeq) nucleotide binding oligomerization domain containing 1
  KO
K08727  nucleotide-binding oligomerization domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05133  Pertussis
Network
nt06139  NLR signaling (viruses and bacteria)
  Element
N00940  NOD-NFKB signaling pathway
Disease
H01358  Atopic dermatitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    10392 (NOD1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    10392 (NOD1)
   05131 Shigellosis
    10392 (NOD1)
   05133 Pertussis
    10392 (NOD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    10392 (NOD1)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   10392 (NOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT LRR_6 CARD NLRC4_HD2 LRR_4 NOD2_WH AAA_16 AAA_18 ABC_tran AAA_22 RsgA_GTPase Roc
Motif
Other DBs
NCBI-GeneID: 10392
NCBI-ProteinID: NP_006083
OMIM: 605980
HGNC: 16390
Ensembl: ENSG00000106100
Vega: OTTHUMG00000023923
Pharos: Q9Y239(Tchem)
UniProt: Q9Y239 A0A024RA73
Structure
PDB: 

Position
7p14.3
AA seq 953 aa AA seqDB search
MEEQGHSEMEIIPSESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCA
CPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLLEIGFSPSLLTQSKVV
VNTDPVSRYTQQLRHHLGRDSKFVLCYAQKEELLLEEIYMDTIMELVGFSNESLGSLNSL
ACLLDHTTGILNEQGETIFILGDAGVGKSMLLQRLQSLWATGRLDAGVKFFFHFRCRMFS
CFKESDRLCLQDLLFKHYCYPERDPEEVFAFLLRFPHVALFTFDGLDELHSDLDLSRVPD
SSCPWEPAHPLVLLANLLSGKLLKGASKLLTARTGIEVPRQFLRKKVLLRGFSPSHLRAY
ARRMFPERALQDRLLSQLEANPNLCSLCSVPLFCWIIFRCFQHFRAAFEGSPQLPDCTMT
LTDVFLLVTEVHLNRMQPSSLVQRNTRSPVETLHAGRDTLCSLGQVAHRGMEKSLFVFTQ
EEVQASGLQERDMQLGFLRALPELGPGGDQQSYEFFHLTLQAFFTAFFLVLDDRVGTQEL
LRFFQEWMPPAGAATTSCYPPFLPFQCLQGSGPAREDLFKNKDHFQFTNLFLCGLLSKAK
QKLLRHLVPAAALRRKRKALWAHLFSSLRGYLKSLPRVQVESFNQVQAMPTFIWMLRCIY
ETQSQKVGQLAARGICANYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGV
RELQPCFSRLTVLRLSVNQITDGGVKVLSEELTKYKIVTYLGLYNNQITDVGARYVTKIL
DECKGLTHLKLGKNKITSEGGKYLALAVKNSKSISEVGMWGNQVGDEGAKAFAEALRNHP
SLTTLSLASNGISTEGGKSLARALQQNTSLEILWLTQNELNDEVAESLAEMLKVNQTLKH
LWLIQNQITAKGTAQLADALQSNTGITEICLNGNLIKPEEAKVYEDEKRIICF
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atggaagagcagggccacagtgagatggaaataatcccatcagagtctcacccccacatt
caattactgaaaagcaatcgggaacttctggtcactcacatccgcaatactcagtgtctg
gtggacaacttgctgaagaatgactacttctcggccgaagatgcggagattgtgtgtgcc
tgccccacccagcctgacaaggtccgcaaaattctggacctggtacagagcaagggcgag
gaggtgtccgagttcttcctctacttgctccagcaactcgcagatgcctacgtggacctc
aggccttggctgctggagatcggcttctccccttccctgctcactcagagcaaagtcgtg
gtcaacactgacccagtgagcaggtatacccagcagctgcgacaccatctgggccgtgac
tccaagttcgtgctgtgctatgcccagaaggaggagctgctgctggaggagatctacatg
gacaccatcatggagctggttggcttcagcaatgagagcctgggcagcctgaacagcctg
gcctgcctcctggaccacaccaccggcatcctcaatgagcagggtgagaccatcttcatc
ctgggtgatgctggggtgggcaagtccatgctgctacagcggctgcagagcctctgggcc
acgggccggctagacgcaggggtcaaattcttcttccactttcgctgccgcatgttcagc
tgcttcaaggaaagtgacaggctgtgtctgcaggacctgctcttcaagcactactgctac
ccagagcgggaccccgaggaggtgtttgccttcctgctgcgcttcccccacgtggccctc
ttcaccttcgatggcctggacgagctgcactcggacttggacctgagccgcgtgcctgac
agctcctgcccctgggagcctgcccaccccctggtcttgctggccaacctgctcagtggg
aagctgctcaagggggctagcaagctgctcacagcccgcacaggcatcgaggtcccgcgc
cagttcctgcggaagaaggtgcttctccggggcttctcccccagccacctgcgcgcctat
gccaggaggatgttccccgagcgggccctgcaggaccgcctgctgagccagctggaggcc
aaccccaacctctgcagcctgtgctctgtgcccctcttctgctggatcatcttccggtgc
ttccagcacttccgtgctgcctttgaaggctcaccacagctgcccgactgcacgatgacc
ctgacagatgtcttcctcctggtcactgaggtccatctgaacaggatgcagcccagcagc
ctggtgcagcggaacacacgcagcccagtggagaccctccacgccggccgggacactctg
tgctcgctggggcaggtggcccaccggggcatggagaagagcctctttgtcttcacccag
gaggaggtgcaggcctccgggctgcaggagagagacatgcagctgggcttcctgcgggct
ttgccggagctgggccccgggggtgaccagcagtcctatgagtttttccacctcaccctc
caggccttctttacagccttcttcctcgtgctggacgacagggtgggcactcaggagctg
ctcaggttcttccaggagtggatgccccctgcgggggcagcgaccacgtcctgctatcct
cccttcctcccgttccagtgcctgcagggcagtggtccggcgcgggaagacctcttcaag
aacaaggatcacttccagttcaccaacctcttcctgtgcgggctgttgtccaaagccaaa
cagaaactcctgcggcatctggtgcccgcggcagccctgaggagaaagcgcaaggccctg
tgggcacacctgttttccagcctgcggggctacctgaagagcctgccccgcgttcaggtc
gaaagcttcaaccaggtgcaggccatgcccacgttcatctggatgctgcgctgcatctac
gagacacagagccagaaggtggggcagctggcggccaggggcatctgcgccaactacctc
aagctgacctactgcaacgcctgctcggccgactgcagcgccctctccttcgtcctgcat
cacttccccaagcggctggccctagacctagacaacaacaatctcaacgactacggcgtg
cgggagctgcagccctgcttcagccgcctcactgttctcagactcagcgtaaaccagatc
actgacggtggggtaaaggtgctaagcgaagagctgaccaaatacaaaattgtgacctat
ttgggtttatacaacaaccagatcaccgatgtcggagccaggtacgtcaccaaaatcctg
gatgaatgcaaaggcctcacgcatcttaaactgggaaaaaacaaaataacaagtgaagga
gggaagtatctcgccctggctgtgaagaacagcaaatcaatctctgaggttgggatgtgg
ggcaatcaagttggggatgaaggagcaaaagccttcgcagaggctctgcggaaccacccc
agcttgaccaccctgagtcttgcgtccaacggcatctccacagaaggaggaaagagcctt
gcgagggccctgcagcagaacacgtctctagaaatactgtggctgacccaaaatgaactc
aacgatgaagtggcagagagtttggcagaaatgttgaaagtcaaccagacgttaaagcat
ttatggcttatccagaatcagatcacagctaaggggactgcccagctggcagatgcgtta
cagagcaacactggcataacagagatttgcctaaatggaaacctgataaaaccagaggag
gccaaagtctatgaagatgagaagcggattatctgtttctga

DBGET integrated database retrieval system