KEGG   Homo sapiens (human): 10930
Entry
10930             CDS       T01001                                 

Gene name
APOBEC2, ARCD1, ARP1
Definition
(RefSeq) apolipoprotein B mRNA editing enzyme catalytic subunit 2
  KO
K18772  C->U-editing enzyme APOBEC2 [EC:3.5.4.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    10930 (APOBEC2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.-  
     10930 (APOBEC2)
SSDB
Motif
Pfam: APOBEC2 NAD1 APOBEC_N NAD2 SNAD4 APOBEC_C APOBEC3 APOBEC4_like APOBEC4 APOBEC1 dCMP_cyt_deam_1 MafB19-deam Flavoprotein
Other DBs
NCBI-GeneID: 10930
NCBI-ProteinID: NP_006780
OMIM: 604797
HGNC: 605
Ensembl: ENSG00000124701
Vega: OTTHUMG00000014670
Pharos: Q9Y235(Tbio)
UniProt: Q9Y235
Structure
PDB: 
2NYT

Position
6p21.1
AA seq 224 aa
MAQKEEAAVATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVE
YSSGRNKTFLCYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVT
WYVSSSPCAACADRIIKTLSKTKNLRLLILVGRLFMWEEPEIQAALKKLKEAGCKLRIMK
PQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADILK
NT seq 675 nt   +upstreamnt  +downstreamnt
atggcccagaaggaagaggctgctgtggccactgaggctgcctcccagaatggggaggat
ctggagaacctggacgaccctgagaagctgaaagagctgattgagctgccgccctttgag
attgtcacaggagaacggctgcctgccaacttctttaaattccagttccggaatgtggag
tacagttccgggaggaacaagaccttcctctgctatgtggttgaagcacagggcaagggg
ggccaagtgcaggcatctcggggatacctagaggatgagcatgcggctgcccatgcagag
gaagctttcttcaacaccatcctgccagccttcgacccagccctgcggtacaatgtcacc
tggtatgtgtcctccagcccctgtgcagcgtgtgctgaccgcattatcaaaacccttagc
aagaccaagaacctgcgtctgctcattctggtgggtcgactcttcatgtgggaggagccg
gagatccaggctgctctgaagaagctgaaggaggctggctgtaaactgcgcatcatgaag
ccccaggacttcgaatatgtctggcagaattttgtggagcaagaagagggtgaatccaag
gcctttcagccctgggaggacattcaggagaacttcctatactacgaggagaagttggca
gacatcctgaagtag

DBGET integrated database retrieval system