KEGG   Homo sapiens (human): 11095
Entry
11095             CDS       T01001                                 

Gene name
ADAMTS8, ADAM-TS8, METH2
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 8
  KO
K08623  a disintegrin and metalloproteinase with thrombospondin motifs 8 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    11095 (ADAMTS8)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     11095 (ADAMTS8)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   11095 (ADAMTS8)
SSDB
Motif
Pfam: ADAM_spacer1 ADAM_CR_2 Reprolysin Pep_M12B_propep Reprolysin_5 TSP1_ADAMTS TSP_1 Reprolysin_3 TSP1_spondin Reprolysin_2 TSP1_CCN Reprolysin_4 Peptidase_M7
Other DBs
NCBI-GeneID: 11095
NCBI-ProteinID: NP_008968
OMIM: 605175
HGNC: 224
Ensembl: ENSG00000134917
Vega: OTTHUMG00000165656
Pharos: Q9UP79(Tbio)
UniProt: Q9UP79 Q5FWF1
Position
11q24.3
AA seq 889 aa
MLPAPAAPRWPPLLLLLLLLLPLARGAPARPAAGGQASELVVPTRLPGSAGELALHLSAF
GKGFVLRLAPDDSFLAPEFKIERLGGSGRATGGERGLRGCFFSGTVNGEPESLAAVSLCR
GLSGSFLLDGEEFTIQPQGAGGSLAQPHRLQRWGPAGARPLPRGPEWEVETGEGQRQERG
DHQEDSEEESQEEEAEGASEPPPPLGATSRTKRFVSEARFVETLLVADASMAAFYGADLQ
NHILTLMSVAARIYKHPSIKNSINLMVVKVLIVEDEKWGPEVSDNGGLTLRNFCNWQRRF
NQPSDRHPEHYDTAILLTRQNFCGQEGLCDTLGVADIGTICDPNKSCSVIEDEGLQAAHT
LAHELGHVLSMPHDDSKPCTRLFGPMGKHHVMAPLFVHLNQTLPWSPCSAMYLTELLDGG
HGDCLLDAPAAALPLPTGLPGRMALYQLDQQCRQIFGPDFRHCPNTSAQDVCAQLWCHTD
GAEPLCHTKNGSLPWADGTPCGPGHLCSEGSCLPEEEVERPKPVADGGWAPWGPWGECSR
TCGGGVQFSHRECKDPEPQNGGRYCLGRRAKYQSCHTEECPPDGKSFREQQCEKYNAYNY
TDMDGNLLQWVPKYAGVSPRDRCKLFCRARGRSEFKVFEAKVIDGTLCGPETLAICVRGQ
CVKAGCDHVVDSPRKLDKCGVCGGKGNSCRKVSGSLTPTNYGYNDIVTIPAGATNIDVKQ
RSHPGVQNDGNYLALKTADGQYLLNGNLAISAIEQDILVKGTILKYSGSIATLERLQSFR
PLPEPLTVQLLTVPGEVFPPKVKYTFFVPNDVDFSMQSSKERATTNIIQPLLHAQWVLGD
WSECSSTCGAGWQRRTVECRDPSGQASATCNKALKPEDAKPCESQLCPL
NT seq 2670 nt   +upstreamnt  +downstreamnt
atgctccccgcccccgccgccccccggtggcctccgctcctgctgctgctgctgctgctg
ctgccgctggcccgcggcgccccggcccggcccgcagccggggggcaggcctcggagctg
gtggtgcccacgcggttgcccggcagcgcgggcgagctcgcgctccacctgtccgccttc
ggcaagggcttcgtgctgcgcctggcgcccgacgacagcttcctagcgcccgagttcaag
atcgagcgcctcgggggctccggccgggcgaccgggggcgagcgggggctgcgcggctgc
ttcttctccggcaccgtgaatggggagcccgagtcgctggcggcggtcagcctgtgccgc
gggctgagcggctccttcctgctggacggcgaggagttcaccatccagccgcagggcgcg
gggggctccctggctcagccgcaccgcctgcagcgctggggtcccgccggagcccgcccc
ctcccgcgaggacccgagtgggaggtggagacgggagagggtcagaggcaggagagagga
gaccaccaggaggacagcgaggaggagagccaagaagaggaggcagaaggcgctagcgag
ccgccaccgcccctgggggccacgagtaggaccaagcggtttgtgtctgaggcgcgcttc
gtggagacgctgctggtggccgatgcgtccatggctgccttctacggggccgacctgcag
aaccacatcctgacgttaatgtctgtggcagcccgaatctacaagcaccccagcatcaag
aattccatcaacctgatggtggtaaaagtgctgatcgtagaagatgaaaaatggggccca
gaggtgtccgacaatggggggcttacactgcgtaacttctgcaactggcagcggcgtttc
aaccagcccagcgaccgccacccagagcactacgacacggccatcctgctcaccagacag
aacttctgtgggcaggaggggctgtgtgacaccctgggtgtggcagacatcgggaccatt
tgtgaccccaacaaaagctgctccgtgatcgaggatgaggggctccaggcggcccacacc
ctggcccatgaactagggcacgtcctcagcatgccccacgacgactccaagccctgcaca
cggctcttcgggcccatgggcaagcaccacgtgatggcaccgctgttcgtccacctgaac
cagacgctgccctggtccccctgcagcgccatgtatctcacagagcttctggacggcggg
cacggagactgtctcctggatgcccctgctgcggccctgcccctccccacaggcctcccg
ggccgcatggccctgtaccagctggaccagcagtgcaggcagatctttgggccggatttc
cgccactgccccaacacctctgctcaggacgtctgcgcccagctttggtgccacactgat
ggggctgagcccctgtgccacacgaagaatggcagcctgccctgggctgacggcacgccg
tgcgggcctgggcacctctgctcagaaggcagctgtctacctgaggaggaagtggagagg
cccaagcccgtggcagatggaggctgggcaccgtggggaccctggggagaatgttctcgg
acctgtggaggaggagtacagttttcacaccgtgagtgcaaggaccccgagcctcagaat
ggaggaagatactgcctgggtcggagagccaagtaccagtcatgccacacggaggaatgc
ccccctgacgggaaaagcttcagggagcagcagtgtgagaagtataatgcctacaattac
actgacatggacgggaatctcctgcagtgggtccccaagtatgctggggtgtccccccgg
gaccgctgcaagttgttctgccgagcccgggggaggagcgagttcaaagtgttcgaggcc
aaggtgattgatggcaccctgtgtgggccagaaacactggccatctgtgtccgtggccag
tgtgtcaaggccggctgtgaccatgtggtggactcgcctcggaagctggacaaatgcggg
gtgtgtgggggcaaaggcaactcctgcaggaaggtctccgggtccctcacccccaccaat
tatggctacaatgacattgtcaccatcccagctggtgccactaatattgacgtgaagcag
cggagccacccgggtgtgcagaacgatgggaactacctggcgctgaagacggctgatggg
cagtacctgctcaacggcaacctggccatctctgccatagagcaggacatcttggtgaag
gggaccatcctgaagtacagcggctccatcgccaccctggagcgcctgcagagcttccgg
cccttgccagagcctctgacagtgcagctcctgacagtccctggcgaggtcttcccccca
aaagtcaaatacaccttctttgttcctaatgacgtggactttagcatgcagagcagcaaa
gagagagcaaccaccaacatcatccagccgctgctccacgcacagtgggtgctgggggac
tggtctgagtgctctagcacctgcggggccggctggcagaggcgaactgtagagtgcagg
gacccctccggccaggcctctgccacctgcaacaaggctctgaaacccgaggatgccaag
ccctgcgaaagccagctgtgccccctgtga

DBGET integrated database retrieval system