KEGG   Homo sapiens (human): 125061Help
Entry
125061            CDS       T01001                                 

Gene name
AFMID, FKF, KF, KFA
Definition
(RefSeq) arylformamidase
  KO
K01432  arylformamidase [EC:3.5.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00380  Tryptophan metabolism
hsa00630  Glyoxylate and dicarboxylate metabolism
hsa01100  Metabolic pathways
Module
hsa_M00038  Tryptophan metabolism, tryptophan => kynurenine => 2-aminomuconate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    125061 (AFMID)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    125061 (AFMID)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.9  arylformamidase
     125061 (AFMID)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_3 COesterase Abhydrolase_6 Hydrolase_4 Peptidase_S9 LIDHydrolase FSH1 Lipase_3 NYN
Motif
Other DBs
NCBI-GeneID: 125061
NCBI-ProteinID: NP_001010982
HGNC: 20910
Ensembl: ENSG00000183077
Vega: OTTHUMG00000153957
Pharos: Q63HM1(Tbio)
UniProt: Q63HM1
Position
17q25.3
AA seq 303 aa AA seqDB search
MMDVSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEATTRARATR
KSLLHVPYGDGEGEKVDIYFPDESSEALPFFLFFHGGYWQSGSKDESAFMVHPLTAQGVA
VVIVAYGIAPKGTLDHMVDQVTRSVAFVQKRYPSNKGIYLCGHSAGAHLAAMMLLADWTK
HGVTPNLRGFFLVSGVFDLEPIVYTSQNVALQLTLEDAQRNSPQLKVAQAQPVDPTCRVL
VVVGQFDSPEFHRQSWEFYQTLCQGEWKASFEELHDVDHFEIVENLTQKDNVLTQIILKT
IFQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatggatgtgtctggtgtgggtttcccaagcaaggttccttggaagaagatgtctgca
gaggagctggagaatcagtactgtcccagccgatgggttgtccgactgggagcagaggaa
gccttgaggacctactcacagataggaattgaagccaccacaagggcccgggccaccagg
aagagcctgctgcatgtcccctatggagacggcgaaggggagaaagtggacatttacttc
cccgacgagtcgtctgaagccttgcctttcttcctgttctttcacggaggatactggcag
agcggaagtaaggatgagtctgccttcatggtccacccgctgacggcacagggagtggcc
gtggtaatagtggcttacggcatcgcccccaaaggcaccctggaccacatggtagaccag
gtgacccgcagcgttgcgtttgtccagaagcggtatccaagcaacaagggaatttacctg
tgtggacactcagccggggcccacctggctgccatgatgctcctggccgactggaccaag
catggggtcacgcccaacctcagaggctttttcctggtgagtggggtctttgacctggag
cccatcgtgtatacttcacagaacgttgctctccagctgaccctggaggacgctcagagg
aatagcccccagctgaaggtggcccaggcacagccggtggaccccacctgccgtgtgctg
gtggtcgtgggccagttcgactcccccgaattccaccgacagtcctgggagttttaccag
accctgtgtcaaggagagtggaaagcctcatttgaagagctccacgatgtggaccacttt
gaaattgttgagaatctgacccagaaggacaacgtgctcacccagattatcttgaaaaca
atcttccagtag

DBGET integrated database retrieval system