KEGG   Homo sapiens (human): 136991
Entry
136991            CDS       T01001                                 

Gene name
ASZ1, ALP1, ANKL1, C7orf7, CT1.19, GASZ, Orf3
Definition
(RefSeq) ankyrin repeat, SAM and basic leucine zipper domain containing 1
  KO
K18410  ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    136991 (ASZ1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Gene silencing
   piRNA pathway
    136991 (ASZ1)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank Ank_3 Ank_4 SAM_2 SAM_1
Other DBs
NCBI-GeneID: 136991
NCBI-ProteinID: NP_570124
OMIM: 605797
HGNC: 1350
Ensembl: ENSG00000154438
Vega: OTTHUMG00000064565
Pharos: Q8WWH4(Tbio)
UniProt: Q8WWH4
Position
7q31.2
AA seq 475 aa
MAASALRGLPVAGGGESSESEDDGWEIGYLDRTSQKLKRLLPIEEKKEKFKKAMTIGDVS
LVQELLDSGISVDSNFQYGWTPLMYAASVANAELVRVLLDRGANASFEKDKQSILITACS
AHGSEEQILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDE
NGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNP
LEGKLQQLTKEDTICKILTTDSDREKDHIFSSYTAFGDLEVFLHGLGLEHMTDLLKERDI
TLRHLLTMREDEFTKNGITSKDQQKILAALKELQVEEIQFGELSEETKLEISGDEFLNFL
LKLNKQCGHLITAVQNVITELPVNSQKITLEWASPQNFTSVCEELVNNVEDLSEKVCKLK
DLIQKLQNERENDPTHIQLREEVSTWNSRILKRTAITICGFGFLLFICKLTFQRK
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcggcgagcgcgctgcgaggcctgccagtggctggcggaggcgagagtagcgagagc
gaggatgatggctgggagattgggtatctcgaccggacgtctcagaaattgaaaaggcta
ttacccattgaagaaaagaaagaaaaatttaagaaagcaatgaccatcggagatgtttca
ttggtccaggagctcctagattctggcattagtgtagattccaactttcagtatggatgg
actccccttatgtatgctgctagtgttgccaatgcagagctggttcgggtccttttggac
agaggtgctaatgcaagctttgagaaggataagcaaagtattttgataactgcatgttct
gctcatggctcagaggaacagatcttgaagtgtgtagaactactactttcaagaaatgct
gatccaaatgttgcttgtaggagacttatgaccccaatcatgtatgctgctcgagatggt
cacacccaggttgttgctctccttgttgctcatggagcagaagttaatacccaggatgag
aatggttacactgctttaacgtgggcagcacgtcagggtcataaaaatatagttttgaag
ttgcttgaacttggagctaataaaatgctacaaaccaaagatggaaagatgccaagtgag
attgcaaaaagaaacaaacatcatgagatcttcaacttactttcttttactttaaatcca
ttggaaggaaaacttcaacagctaactaaagaagacactatttgtaaaatattgacaaca
gattctgatagagaaaaagatcacatttttagttcatatacagcatttggagatctggaa
gtatttttacatggtcttggacttgaacatatgacagatttactaaaggaaagggatata
acgttaagacatcttttgaccatgagggaagatgaatttacaaagaatggaattaccagt
aaagaccagcagaaaattctggctgctcttaaagaactacaggtagaagagatacaattt
ggagagctatctgaagagacaaagttggaaatcagtggtgatgagttcctcaactttctt
ctcaaattaaataaacagtgtggccatttaataacagctgtacagaatgttattactgag
ttacctgtaaattctcaaaagataacactggaatgggcttctccccagaattttacttca
gtttgtgaagaattggttaataatgttgaagatttgagtgaaaaggtctgcaaactaaaa
gacctaattcaaaagttgcaaaatgaacgggaaaatgatccaactcatatacaattaagg
gaagaagtatctacatggaatagtagaattttgaagaggacagctattaccatatgcgga
ttcggttttcttcttttcatttgcaagctaactttccagaggaaataa

DBGET integrated database retrieval system