KEGG   Homo sapiens (human): 1653Help
Entry
1653              CDS       T01001                                 

Gene name
DDX1, DBP-RB, UKVH5d
Definition
(RefSeq) DEAD-box helicase 1
  KO
K13177  ATP-dependent RNA helicase DDX1 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    1653 (DDX1)
   03016 Transfer RNA biogenesis [BR:hsa03016]
    1653 (DDX1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     1653 (DDX1)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    1653 (DDX1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  tRNA spricing factors
   tRNA splicing ligases
    1653 (DDX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C SPRY CMS1 ResIII
Motif
Other DBs
NCBI-GeneID: 1653
NCBI-ProteinID: NP_004930
OMIM: 601257
HGNC: 2734
Ensembl: ENSG00000079785
Vega: OTTHUMG00000090593
Pharos: Q92499(Tbio)
UniProt: Q92499 A3RJH1
Structure
PDB: 

Position
2p24.3
AA seq 740 aa AA seqDB search
MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPV
IQIVYETLKDQQEGKKGKTTIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWH
GCRATKGLMKGKHYYEVSCHDQGLCRVGWSTMQASLDLGTDKFGFGFGGTGKKSHNKQFD
NYGEEFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAFEIPPHMKNQALFPACVLKNAELKF
NFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAE
QTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTPGRLDDLVSTGKLN
LSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKLSE
KIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGAN
SPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQF
SCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYV
HRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLS
EIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEK
EAQTSFLHLGYLPNQLFRTF
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcggccttctccgagatgggtgtaatgcctgagattgcacaagctgtggaagagatg
gattggctcctcccaactgatatccaggctgaatctatcccattgatcttaggaggaggt
gatgtacttatggctgcagaaacaggaagtggcaaaactggtgcttttagtattccagtt
atccagatagtttatgaaactctgaaagaccaacaggaaggcaaaaaaggaaaaacaaca
attaaaactggtgcttcagtgctgaacaaatggcagatgaacccatatgacagaggatct
gcttttgcaattgggtcagatggtctttgttgtcaaagcagagaagtaaaggaatggcat
gggtgtagagctactaaaggattaatgaaagggaaacactactatgaagtatcctgtcat
gaccaagggttatgcagggtcgggtggtctaccatgcaggcctctttggacctaggtact
gacaagtttggatttggctttggtggaacaggaaagaaatcccataacaaacaatttgat
aattatggagaggaattcactatgcatgataccattggatgttacctggatatagataag
ggacatgtcaagttctccaaaaatggaaaagatcttggtctggcatttgaaataccacca
catatgaaaaaccaagccctctttcctgcctgtgttttgaagaatgctgaactgaaattt
aacttcggtgaagaggaatttaagtttccaccaaaagatggctttgttgctctttccaag
gcaccggatggttacattgtcaaatcacagcactcaggtaatgcacaggtgacacaaaca
aagtttctccccaatgctccgaaagctctcattgttgaaccttcccgggagttagctgaa
caaactttgaacaacatcaagcagtttaagaaatacattgataatcctaaattaagggag
cttctgataattggaggtgttgcagcccgggatcagctctctgttttggaaaatggagta
gatatagttgtaggtactccgggaagactagatgacttggtgtcaactggaaagctgaac
ttatctcaagttagattcctggtcctggatgaagctgatgggcttctttctcaaggttat
tctgattttataaataggatgcacaatcagattcctcaggttacctctgatggaaaaaga
cttcaggtgattgtttgctctgccactttgcattctttcgatgtaaagaaactgtccgag
aagataatgcattttcctacatgggttgacttaaaaggagaagactctgttccagatact
gtacaccatgttgttgtcccagtaaatcccaaaactgacagactctgggaaaggcttgga
aagagccacattagaactgatgatgtacatgcaaaagataacacaagacctggtgctaat
agtccagagatgtggtctgaagctattaaaatcctgaaaggggagtatgctgtccgggca
atcaaggaacataagatggatcaagcaattatcttctgtagaaccaaaattgactgtgat
aacttggagcagtactttatacaacaaggaggaggacctgataaaaaaggacaccagttc
tcatgtgtttgtcttcatggtgacagaaagcctcatgagagaaagcaaaacttggaaaga
tttaagaaaggagatgtaagattcttgatttgcacagatgtagctgctagaggaattgat
atccacggtgttccttatgttataaatgtcactctgcccgatgaaaagcaaaactacgta
catcgaattggcagagtaggaagagctgaaaggatgggtctggcaatttccctggtggca
acagaaaaagaaaaggtttggtaccatgtatgtagcagccgtggaaaagggtgttataac
acaagactcaaggaagatggaggctgtaccatatggtacaacgagatgcagttactatct
gagatagaagaacacctgaactgtaccatttctcaggttgagccggatataaaggtacca
gtggatgaatttgatgggaaagttacctacggtcagaaaagggctgctggtggtggaagc
tataaaggccatgtggatattttggcacctactgttcaagagttggctgcccttgaaaag
gaggcgcagacatctttcctgcatcttggctaccttcctaaccagctgttcagaaccttc
tga

DBGET integrated database retrieval system