KEGG   Homo sapiens (human): 1656Help
Entry
1656              CDS       T01001                                 

Gene name
DDX6, HLR2, P54, RCK
Definition
(RefSeq) DEAD-box helicase 6
  KO
K12614  ATP-dependent RNA helicase DDX6/DHH1 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
Module
hsa_M00395  Decapping complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    1656 (DDX6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:hsa03019]
    1656 (DDX6)
   03036 Chromosome and associated proteins [BR:hsa03036]
    1656 (DDX6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     1656 (DDX6)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     1656 (DDX6)
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     1656 (DDX6)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  RNA silencing
   piRNA pathway
    1656 (DDX6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C CMS1 ResIII ERCC3_RAD25_C
Motif
Other DBs
NCBI-GeneID: 1656
NCBI-ProteinID: NP_001244120
OMIM: 600326
HGNC: 2747
Ensembl: ENSG00000110367
Vega: OTTHUMG00000166411
Pharos: P26196(Tbio)
UniProt: P26196 B2R858
Structure
PDB: 

Position
11q23.3
AA seq 483 aa AA seqDB search
MSTARTENPVIMGLSSQNGQLRGPVKPTGGPGGGGTQTQQQMNQLKNTNTINNGTQQQAQ
SMTTTIKPGDDWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPS
PIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQV
SQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHV
QMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEINL
MEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYS
CFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLH
RIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPVED
EKP
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggccagaacagagaaccctgttataatgggtctgtccagtcaaaatggtcag
ctgagaggccctgtgaaacccactggtggccctggaggagggggcacacagacacagcaa
cagatgaaccagctgaaaaacaccaacacaatcaataatggcactcagcagcaagcacag
agtatgaccaccactattaaacctggtgatgactggaaaaagactttaaaactccctcca
aaggatctaagaatcaaaacttcggatgtgacctccacaaaaggaaatgagtttgaagat
tactgtttgaaacgggagttactgatgggaatttttgaaatgggctgggaaaagccatct
cctattcaggaggagagcattcccattgctttatctggtagggatatcttagctagagca
aaaaatggaacaggcaagagcggtgcctacctcattcccttacttgaacggctagacctg
aagaaggacaatatacaagcaatggtgattgttcccactagagaacttgctctacaggtc
agtcaaatttgcatccaggtcagcaaacacatgggaggggccaaagtgatggcaaccaca
ggaggaaccaatttacgagatgacataatgaggcttgatgatacagtgcacgtggtgatt
gctacccctgggagaatcctggatcttattaagaaaggagtagcaaaggttgatcatgtc
cagatgatagtattggatgaggcagataagttgctgtcacaggattttgtgcagataatg
gaggatattattctcacgctacctaaaaacaggcagattttactatattccgctactttc
cctcttagtgtacagaagttcatgaattcccatttgcagaaaccctatgagattaacctg
atggaggaactaactctgaagggagtaacccagtactacgcatatgtaactgagcgccaa
aaagtacactgcctcaacacacttttctccaggcttcagataaaccagtcgatcattttc
tgtaactcctctcagcgagttgaattgctagccaagaagatttctcaactgggttattct
tgcttctatattcatgctaaaatgaggcaggaacatcgaaatcgtgtatttcatgatttc
cgaaatggcttatgccgcaatcttgtttgcactgatctgtttacccgaggtattgatata
caagctgtgaatgtggtaataaactttgatttcccaaagctggcagagacctatctccat
cgtattggaagatcaggtcgctttggtcatcttggcttagccatcaacttgatcacatat
gatgatcgcttcaacctgaaaagtattgaggagcagctgggaacagaaattaaacctatt
ccgagcaacattgataagagcctgtatgtggcagaataccacagcgagcctgtagaagat
gagaaaccttaa

DBGET integrated database retrieval system