KEGG   Homo sapiens (human): 1763
Entry
1763              CDS       T01001                                 

Symbol
DNA2, DNA2L, hDNA2
Name
(RefSeq) DNA replication helicase/nuclease 2
  KO
K10742  DNA replication ATP-dependent helicase Dna2 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
Disease
H00992  Seckel syndrome
H01118  Progressive external ophthalmoplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    1763 (DNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    1763 (DNA2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     1763 (DNA2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    1763 (DNA2)
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     1763 (DNA2)
SSDB
Motif
Pfam: Dna2 AAA_12 AAA_11 AAA_30 AAA_19 PDDEXK_1 Cas_Cas4 SRP54 Helicase_RecD PhoH UvrD_C_2 CbiA AAA_25 cobW UvrD-helicase AAA_7 AAA_16 BRCC36_C AAA_23
Other DBs
NCBI-GeneID: 1763
NCBI-ProteinID: NP_001073918
OMIM: 601810
HGNC: 2939
Ensembl: ENSG00000138346
Vega: OTTHUMG00000018352
Pharos: P51530(Tbio)
UniProt: P51530
Position
10q21.3
AA seq 1060 aa
MEQLNELELLMEKSFWEEAELPAELFQKKVVASFPRTVLSTGMDNRYLVLAVNTVQNKEG
NCEKRLVITASQSLENKELCILRNDWCSVPVEPGDIIHLEGDCTSDTWIIDKDFGYLILY
PDMLISGTSIASSIRCMRRAVLSETFRSSDPATRQMLIGTVLHEVFQKAINNSFAPEKLQ
ELAFQTIQEIRHLKEMYRLNLSQDEIKQEVEDYLPSFCKWAGDFMHKNTSTDFPQMQLSL
PSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELK
TGKESNSIEHRSQVVLYTLLSQERRADPEAGLLLYLKTGQMYPVPANHLDKRELLKLRNQ
MAFSLFHRISKSATRQKTQLASLPQIIEEEKTCKYCSQIGNCALYSRAVEQQMDCSSVPI
VMLPKIEEETQHLKQTHLEYFSLWCLMLTLESQSKDNKKNHQNIWLMPASEMEKSGSCIG
NLIRMEHVKIVCDGQYLHNFQCKHGAIPVTNLMAGDRVIVSGEERSLFALSRGYVKEINM
TTVTCLLDRNLSVLPESTLFRLDQEEKNCDIDTPLGNLSKLMENTFVSKKLRDLIIDFRE
PQFISYLSSVLPHDAKDTVACILKGLNKPQRQAMKKVLLSKDYTLIVGMPGTGKTTTICT
LVRILYACGFSVLLTSYTHSAVDNILLKLAKFKIGFLRLGQIQKVHPAIQQFTEQEICRS
KSIKSLALLEELYNSQLIVATTCMGINHPIFSRKIFDFCIVDEASQISQPICLGPLFFSR
RFVLVGDHQQLPPLVLNREARALGMSESLFKRLEQNKSAVVQLTVQYRMNSKIMSLSNKL
TYEGKLECGSDKVANAVINLRHFKDVKLELEFYADYSDNPWLMGVFEPNNPVCFLNTDKV
PAPEQVEKGGVSNVTEAKLIVFLTSIFVKAGCSPSDIGIIAPYRQQLKIINDLLARSIGM
VEVNTVDKYQGRDKSIVLVSFVRSNKDGTVGELLKDWRRLNVAITRAKHKLILLGCVPSL
NCYPPLEKLLNHLNSEKLIIDLPSREHESLCHILGDFQRE
NT seq 3183 nt   +upstreamnt  +downstreamnt
atggagcagctgaacgaactggagctgctgatggagaagagtttttgggaggaggcggag
ctgccggcggagctatttcagaagaaagtggtagcttcctttccaagaacagttctgagc
acaggaatggataaccggtacctggtgttggcagtcaatactgtacagaacaaagaggga
aactgtgaaaagcgcctggtcatcactgcttcacagtcactagaaaataaagaactatgc
atccttaggaatgactggtgttctgttccagtagagccaggagatatcattcatttggag
ggagactgcacatctgacacttggataatagataaagattttggatatttgattctgtat
ccagacatgctgatttctggcaccagcatagccagtagtattcgatgtatgagaagagct
gtcctgagtgaaacttttaggagctctgatccagccacacgccaaatgctaattggtacg
gttctccatgaggtgtttcaaaaagccataaataatagctttgccccagaaaagctacaa
gaacttgcttttcaaacaattcaagaaataagacatttgaaggaaatgtaccgcttaaat
ctaagtcaagatgaaataaaacaagaagtagaggactatcttccttcgttttgtaaatgg
gcaggagatttcatgcataaaaacacttcgactgacttccctcagatgcagctctctctg
ccaagtgataatagtaaggataattcaacatgtaacattgaagtcgtgaaaccaatggat
attgaagaaagcatttggtcccctaggtttggattgaaaggcaaaatagatgttacagtt
ggtgtgaaaatacatcgagggtataaaacaaaatacaagataatgccgctggaacttaaa
actggcaaagaatcaaattctattgaacaccgtagtcaggttgttctgtacactctacta
agccaagagagaagagctgatccagaggctggcttgcttctctacctcaagactggtcag
atgtaccctgtgcctgccaaccatctagataaaagagaattattaaagctaagaaaccag
atggcattctcattgtttcaccgtattagcaaatctgctactagacagaagacacagctt
gcttctttgccacaaataattgaggaagagaaaacttgtaaatattgttcacaaattggc
aattgtgctctttatagcagagcagttgaacaacagatggattgtagttcagtcccaatt
gtgatgctgcccaaaatagaagaagaaacccagcatctgaagcaaacacacttagaatat
ttcagcctttggtgtctaatgttaaccctggagtcacaatcgaaggataataaaaagaat
caccaaaatatctggctaatgcctgcttcggaaatggagaagagtggcagttgcattgga
aacctgattagaatggaacatgtaaagatagtttgtgatgggcaatatttacataatttc
caatgtaaacatggtgccatacctgtcacaaatctaatggcaggtgacagagttattgta
agtggagaagaaaggtcactgtttgctttgtctagaggatatgtgaaggagattaacatg
acaacagtaacttgtttattagacagaaacttgtcggtccttccagaatcaactttgttc
agattagaccaagaagaaaaaaattgtgatatagataccccattaggaaatctttccaaa
ttgatggaaaacacgtttgtcagcaaaaaacttcgagatttaattattgactttcgtgaa
cctcagtttatatcctaccttagttctgttcttccacatgatgcaaaggatacagttgcc
tgcattctaaagggtttgaataagcctcagaggcaagcgatgaaaaaggtacttctttca
aaagactacacactcatcgtgggtatgcctgggacaggaaaaacaactacgatatgtact
ctcgtaagaattctctacgcctgtggttttagcgttttgttgaccagctatacacactct
gctgttgacaatattcttttgaagttagccaagtttaaaataggatttttgcgtttgggt
cagattcagaaggttcatccagctatccagcaatttacagagcaagaaatttgcagatca
aagtccattaaatccttagctcttctagaagaactctacaatagtcaacttatagttgca
acaacatgtatgggaataaaccatccaatattttcccgtaaaatttttgatttttgtatt
gtggatgaagcctctcaaattagccaaccaatttgtctgggccccctttttttttcacgg
agatttgtgttagtgggggaccatcagcagcttcctcccctggtgctaaaccgtgaagca
agagctcttggcatgagtgaaagcttattcaagaggctggagcagaataagagtgctgtt
gtacagttaaccgtgcagtacagaatgaacagtaaaattatgtccttaagtaataagctg
acctatgagggcaagctggagtgtggatcagacaaagtggccaatgcagtgataaaccta
cgtcactttaaagatgtgaagctggaactggaattttatgctgactattctgataatcct
tggttgatgggagtatttgaacccaacaatcctgtttgtttccttaatacagacaaggtt
ccagcgccagaacaagttgaaaaaggtggtgtgagcaatgtaacagaagccaaactcata
gttttcctaacctccatttttgttaaggctggatgcagtccctctgatattggtattatt
gcaccgtacaggcagcaattaaagatcatcaatgatttattggcacgttctattgggatg
gtcgaagttaatacagtagacaaataccaaggaagggacaaaagtattgtcctagtatct
tttgttagaagtaataaggatggaactgttggtgaactcttgaaagattggcgacgtctt
aatgttgctataaccagagccaaacataaactgattcttctggggtgtgtgccctcacta
aattgctatcctcctttggagaagctgcttaatcatttaaactcagaaaaattaatcatt
gatcttccatcaagagaacatgaaagtctttgccacatattgggtgactttcaaagagaa
taa

DBGET integrated database retrieval system