KEGG   Homo sapiens (human): 2060
Entry
2060              CDS       T01001                                 

Gene name
EPS15, AF-1P, AF1P, MLLT5
Definition
(RefSeq) epidermal growth factor receptor pathway substrate 15
  KO
K12472  epidermal growth factor receptor substrate 15
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    2060 (EPS15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2060 (EPS15)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    2060 (EPS15)
SSDB
Motif
Pfam: EF-hand_4 EF-hand_1 EF-hand_6 EF-hand_7 Spc7 EF-hand_5 EF-hand_8 DUF3584 ATG16 UPF0242 Crescentin HrpB7 DUF4795 TMF_DNA_bd AAA_13 EzrA Fib_alpha DUF948 RasGAP_C
Other DBs
NCBI-GeneID: 2060
NCBI-ProteinID: NP_001972
OMIM: 600051
HGNC: 3419
Ensembl: ENSG00000085832
Vega: OTTHUMG00000008192
Pharos: P42566(Tbio)
UniProt: P42566
Structure
PDB: 

Position
1p32.3
AA seq 896 aa
MAAAAQLSLTQLSSGNPVYEKYYRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLA
DTDGKGILNKQEFFVALRLVACAQNGLEVSLSSLNLAVPPPRFHDTSSPLLISGTSAAEL
PWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGML
DRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKRKTWVVSPAEKAKYDEIFLKTDKDMD
GFVSGLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKLSKDQFALAFHLISQKLIKGIDPP
HVLTPEMIPPSDRASLQKNIIGSSPVADFSAIKELDTLNNEIVDLQREKNNVEQDLKEKE
DTIKQRTSEVQDLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCA
EEAQLISSLKAELTSQESQISTYEEELAKAREELSRLQQETAELEESVESGKAQLEPLQQ
HLQDSQQEISSMQMKLMEMKDLENHNSQLNWCSSPHSILVNGATDYCSLSTSSSETANLN
EHVEGQSNLESEPIHQESPARSSPELLPSGVTDENEVTTAVTEKVCSELDNNRHSKEEDP
FNVDSSSLTGPVADTNLDFFQSDPFVGSDPFKDDPFGKIDPFGGDPFKGSDPFASDCFFR
QSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESF
GGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTR
PCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADP
SNFANFSAYPSEEDMIEWAKRESEREEEQRLARLNQQEQEDLELAIALSKSEISEA
NT seq 2691 nt   +upstreamnt  +downstreamnt
atggctgcggcggcccagctctctctgacacagttatcaagtgggaatcctgtatatgaa
aaatactatagacaggttgatacaggcaatactggaagggtgttggcttctgatgctgct
gctttcctgaaaaaatcagggcttccagacttgatacttggaaagatttgggatttagcc
gacacagatggcaaaggtatcctgaacaaacaagaattctttgttgctttgcgtcttgtg
gcatgtgcccagaatggattggaagtttcactaagtagtttgaacctggctgttcctcca
ccaagatttcatgataccagtagtcctttgctaatcagtggaacctctgcagctgagctc
ccatgggctgtaaaacctgaagataaggccaaatatgatgcaatatttgatagtttaagc
ccagtgaatggatttctgtctggtgataaagtgaaaccagtgttgctcaactctaagtta
cctgtggatatccttggaagagtttgggagttgagtgatattgaccatgatggaatgctt
gacagagatgagtttgcagttgccatgtttttggtatactgtgcactggagaaagaacct
gtgccaatgtccttgcctccagccttggtgccaccatctaagagaaaaacgtgggttgta
tcccctgcagaaaaagctaaatatgatgaaatcttcctgaaaactgataaagatatggac
ggatttgtgtctggattggaggtccgtgaaatattcttgaaaacaggtttaccttctacc
ttactagcccatatatggtcattatgcgacacaaaggactgtgggaagctttcaaaggat
cagtttgccttggcttttcacttaatcagtcagaagttaatcaagggcattgatcctcct
cacgttcttactcctgaaatgattccaccatcagacagggccagtttacaaaagaacatc
ataggatcaagtcctgttgcagatttctctgctattaaggaactagatactcttaacaat
gaaatagttgacctacagagggaaaagaataatgtggaacaggaccttaaggagaaggaa
gatactattaaacagaggacaagtgaggttcaggatcttcaagatgaagttcaaagggag
aatactaatctgcaaaaactacaggcccagaaacagcaggtacaggaactccttgatgaa
ctggatgagcagaaagcccagctggaggagcaactcaaggaagtcagaaagaaatgtgct
gaggaggcccaactgatctcttctctgaaagctgaattaactagtcaggaatcgcagatc
tccacttacgaagaagaattggcaaaagctagagaagagctgagccgtctacagcaagaa
acagcagaattggaggagagtgtagagtcagggaaggctcagttggaacctcttcagcag
cacctacaagattcacaacaggaaattagttcaatgcaaatgaaactgatggaaatgaaa
gatttggaaaatcataatagtcagttaaattggtgcagtagcccacacagcattcttgta
aacggagctacagattattgcagcctcagcaccagcagcagtgaaacagccaaccttaat
gaacatgttgaaggccagagcaacctagagtctgagcccatacaccaggaatctccagca
agaagtagtcctgaactactgccttctggtgtgactgatgaaaatgaggtgactacagct
gttactgaaaaagtttgttctgaactcgacaataatagacattcaaaagaggaagatcca
tttaatgtagactcaagttcgctgacaggtccagttgcagatacaaacttggattttttc
cagtctgatccttttgttggcagtgatcctttcaaggatgatccttttggaaaaatcgat
ccatttggtggtgatcctttcaaaggttcagatccatttgcatcagactgtttcttcagg
caatctactgatccttttgccacttcaagcactgaccctttcagtgcagccaacaatagc
agtattacatcggtagaaacgttgaagcacaatgatccttttgctcctggtggaacagtt
gttgcagcaagcgattcagccacagacccctttgcttctgtttttgggaatgaatcattt
ggaggtggatttgctgacttcagcacattgtcaaaggtcaacaatgaagatccttttcgt
tcagccacatcgagctctgtcagcaacgtagtgattacaaaaaatgtatttgaggaaaca
tcggtcaaaagtgaagatgaacccccagcactgccaccaaagatcggaactccaacaaga
ccctgccctctaccacctgggaaaagatccatcaacaaattggattctcctgatcccttt
aaactgaatgatccatttcagcctttcccaggcaacgatagccccaaagaaaaagatcct
gaaatattttgtgatccattcacttctgctactaccactaccaataaagaggctgatcca
agcaattttgccaacttcagtgcttatccctctgaagaagatatgatcgaatgggccaag
agggaaagtgagagagaggaagagcagaggcttgcccgactaaatcagcaggaacaagaa
gacttagaactggctattgcactcagcaaatctgagatatcagaagcatga

DBGET integrated database retrieval system