KEGG   Homo sapiens (human): 2208Help
Entry
2208              CDS       T01001                                 

Gene name
FCER2, BLAST-2, CD23, CD23A, CLEC4J, FCE2, IGEBF
Definition
(RefSeq) Fc fragment of IgE receptor II
  KO
K06468  low affinity immunoglobulin epsilon Fc receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04640  Hematopoietic cell lineage
hsa05169  Epstein-Barr virus infection
Network
nt06165  Epstein-Barr virus (EBV)
  Element
N00225  EBV EBNA2 to RBP-Jk-mediated transcription
Drug target
Lumiliximab: D06463
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    2208 (FCER2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    2208 (FCER2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2208 (FCER2)
   04091 Lectins [BR:hsa04091]
    2208 (FCER2)
CD molecules [BR:hsa04090]
 Proteins
  2208 (FCER2)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    2208 (FCER2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C AIP3 DUF3584 UPF0242 HemX DUF4763 UL45 Golgin_A5 DUF4428 HAUS-augmin3 Zw10 Peptidase_M73 Exonuc_VII_L
Motif
Other DBs
NCBI-GeneID: 2208
NCBI-ProteinID: NP_001207429
OMIM: 151445
HGNC: 3612
Ensembl: ENSG00000104921
Vega: OTTHUMG00000182517
Pharos: P06734(Tchem)
UniProt: P06734
Structure
PDB: 

Position
19p13.2
AA seq 321 aa AA seqDB search
MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERA
ARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADL
SSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKG
TKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHV
DYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESM
GPDSRPDPDGRLPTPSAPLHS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaggtcaatattcagagatcgaggagcttcccaggaggcggtgttgcaggcgt
gggactcagatcgtgctgctggggctggtgaccgccgctctgtgggctgggctgctgact
ctgcttctcctgtggcactgggacaccacacagagtctaaaacagctggaagagagggct
gcccggaacgtctctcaagtttccaagaacttggaaagccaccacggtgaccagatggcg
cagaaatcccagtccacgcagatttcacaggaactggaggaacttcgagctgaacagcag
agattgaaatctcaggacttggagctgtcctggaacctgaacgggcttcaagcagatctg
agcagcttcaagtcccaggaattgaacgagaggaacgaagcttcagatttgctggaaaga
ctccgggaggaggtgacaaagctaaggatggagttgcaggtgtccagcggctttgtgtgc
aacacgtgccctgaaaagtggatcaatttccaacggaagtgctactacttcggcaagggc
accaagcagtgggtccacgcccggtatgcctgtgacgacatggaagggcagctggtcagc
atccacagcccggaggagcaggacttcctgaccaagcatgccagccacaccggctcctgg
attggccttcggaacttggacctgaagggggagtttatctgggtggatgggagccacgtg
gactacagcaactgggctccaggggagcccaccagccggagccagggcgaggactgcgtg
atgatgcggggctccggtcgctggaacgacgccttctgcgaccgtaagctgggcgcctgg
gtgtgcgaccggctggccacatgcacgccgccagccagcgaaggttccgcggagtccatg
ggacctgattcaagaccagaccctgacggccgcctgcccaccccctctgcccctctccac
tcttga

DBGET integrated database retrieval system