KEGG   Homo sapiens (human): 25Help
Entry
25                CDS       T01001                                 

Gene name
ABL1, ABL, CHDSKM, JTK7, bcr/abl, c-ABL, c-ABL1, p150, v-abl
Definition
(RefSeq) ABL proto-oncogene 1, non-receptor tyrosine kinase
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04110  Cell cycle
hsa04360  Axon guidance
hsa04722  Neurotrophin signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05220  Chronic myeloid leukemia
hsa05416  Viral myocarditis
Network
N00002  BCR-ABL fusion kinase to RAS-ERK signaling pathway
N00048  BCR-ABL fusion kinase to PI3K signaling pathway
N00055  BCR-ABL fusion kinase to Jak-STAT signaling pathway
N10001  First-generation tyrosine kinase inhibitor to BCR-ABL fusion
N10002  Second/third-generation tyrosine kinase inhibitor to BCR-ABL fusion
Disease
H00001  B lymphoblastic leukemia/lymphoma
H00004  Chronic myeloid leukemia (CML)
Drug target
Bafetinib: D10202
Bosutinib (DG00718): D03252 D09728
Dasatinib (DG00714): D03658 D06414
Imatinib (DG00710): D01441 D08066
Nilotinib (DG00716): D06413 D08953
Ponatinib (DG00722): D09950 D09951
Rebastinib (DG01368): D10334 D10399
Saracatinib (DG01418): D09664 D09665
Tozasertib (DG01365): D08279 D08344
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    25 (ABL1)
   04012 ErbB signaling pathway
    25 (ABL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    25 (ABL1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    25 (ABL1)
  09158 Development
   04360 Axon guidance
    25 (ABL1)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    25 (ABL1)
   05206 MicroRNAs in cancer
    25 (ABL1)
   05220 Chronic myeloid leukemia
    25 (ABL1)
  09165 Cardiovascular diseases
   05416 Viral myocarditis
    25 (ABL1)
  09167 Infectious diseases
   05130 Pathogenic Escherichia coli infection
    25 (ABL1)
   05131 Shigellosis
    25 (ABL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    25 (ABL1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     25 (ABL1)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  ABL family
   25 (ABL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase F_actin_bind SH2 SH3_1 SH3_9 SH3_2 SH3_3 Haspin_kinase SH3_6
Motif
Other DBs
NCBI-GeneID: 25
NCBI-ProteinID: NP_005148
OMIM: 189980
HGNC: 76
Ensembl: ENSG00000097007
Vega: OTTHUMG00000020813
Pharos: P00519(Tclin)
UniProt: P00519 A0A024R8E2 Q59FK4
Structure
PDB: 

Position
9q34.12
AA seq 1130 aa AA seqDB search
MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSE
NDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
SLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTAS
DGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERT
DITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQ
LLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFI
HRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKS
DVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNP
SDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAE
HRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLF
SALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSP
KPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRFLRSCSAS
CVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTV
TPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGS
ALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPP
PPPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVL
PATPKPQSAKPSGTPISPAPVPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPE
RIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNK
FAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIVQR
NT seq 3393 nt NT seq  +upstreamnt  +downstreamnt
atgttggagatctgcctgaagctggtgggctgcaaatccaagaaggggctgtcctcgtcc
tccagctgttatctggaagaagcccttcagcggccagtagcatctgactttgagcctcag
ggtctgagtgaagccgctcgttggaactccaaggaaaaccttctcgctggacccagtgaa
aatgaccccaaccttttcgttgcactgtatgattttgtggccagtggagataacactcta
agcataactaaaggtgaaaagctccgggtcttaggctataatcacaatggggaatggtgt
gaagcccaaaccaaaaatggccaaggctgggtcccaagcaactacatcacgccagtcaac
agtctggagaaacactcctggtaccatgggcctgtgtcccgcaatgccgctgagtatctg
ctgagcagcgggatcaatggcagcttcttggtgcgtgagagtgagagcagtcctggccag
aggtccatctcgctgagatacgaagggagggtgtaccattacaggatcaacactgcttct
gatggcaagctctacgtctcctccgagagccgcttcaacaccctggccgagttggttcat
catcattcaacggtggccgacgggctcatcaccacgctccattatccagccccaaagcgc
aacaagcccactgtctatggtgtgtcccccaactacgacaagtgggagatggaacgcacg
gacatcaccatgaagcacaagctgggcgggggccagtacggggaggtgtacgagggcgtg
tggaagaaatacagcctgacggtggccgtgaagaccttgaaggaggacaccatggaggtg
gaagagttcttgaaagaagctgcagtcatgaaagagatcaaacaccctaacctggtgcag
ctccttggggtctgcacccgggagcccccgttctatatcatcactgagttcatgacctac
gggaacctcctggactacctgagggagtgcaaccggcaggaggtgaacgccgtggtgctg
ctgtacatggccactcagatctcgtcagccatggagtacctggagaagaaaaacttcatc
cacagagatcttgctgcccgaaactgcctggtaggggagaaccacttggtgaaggtagct
gattttggcctgagcaggttgatgacaggggacacctacacagcccatgctggagccaag
ttccccatcaaatggactgcacccgagagcctggcctacaacaagttctccatcaagtcc
gacgtctgggcatttggagtattgctttgggaaattgctacctatggcatgtccccttac
ccgggaattgacctgtcccaggtgtatgagctgctagagaaggactaccgcatggagcgc
ccagaaggctgcccagagaaggtctatgaactcatgcgagcatgttggcagtggaatccc
tctgaccggccctcctttgctgaaatccaccaagcctttgaaacaatgttccaggaatcc
agtatctcagacgaagtggaaaaggagctggggaaacaaggcgtccgtggggctgtgagt
accttgctgcaggccccagagctgcccaccaagacgaggacctccaggagagctgcagag
cacagagacaccactgacgtgcctgagatgcctcactccaagggccagggagagagcgat
cctctggaccatgagcctgccgtgtctccattgctccctcgaaaagagcgaggtcccccg
gagggcggcctgaatgaagatgagcgccttctccccaaagacaaaaagaccaacttgttc
agcgccttgatcaagaagaagaagaagacagccccaacccctcccaaacgcagcagctcc
ttccgggagatggacggccagccggagcgcagaggggccggcgaggaagagggccgagac
atcagcaacggggcactggctttcacccccttggacacagctgacccagccaagtcccca
aagcccagcaatggggctggggtccccaatggagccctccgggagtccgggggctcaggc
ttccggtctccccacctgtggaagaagtccagcacgctgaccagcagccgcctagccacc
ggcgaggaggagggcggtggcagctccagcaagcgcttcctgcgctcttgctccgcctcc
tgcgttccccatggggccaaggacacggagtggaggtcagtcacgctgcctcgggacttg
cagtccacgggaagacagtttgactcgtccacatttggagggcacaaaagtgagaagccg
gctctgcctcggaagagggcaggggagaacaggtctgaccaggtgacccgaggcacagta
acgcctccccccaggctggtgaaaaagaatgaggaagctgctgatgaggtcttcaaagac
atcatggagtccagcccgggctccagcccgcccaacctgactccaaaacccctccggcgg
caggtcaccgtggcccctgcctcgggcctcccccacaaggaagaagctggaaagggcagt
gccttagggacccctgctgcagctgagccagtgacccccaccagcaaagcaggctcaggt
gcaccagggggcaccagcaagggccccgccgaggagtccagagtgaggaggcacaagcac
tcctctgagtcgccagggagggacaaggggaaattgtccaggctcaaacctgccccgccg
cccccaccagcagcctctgcagggaaggctggaggaaagccctcgcagagcccgagccag
gaggcggccggggaggcagtcctgggcgcaaagacaaaagccacgagtctggttgatgct
gtgaacagtgacgctgccaagcccagccagccgggagagggcctcaaaaagcccgtgctc
ccggccactccaaagccacagtccgccaagccgtcggggacccccatcagcccagccccc
gttccctccacgttgccatcagcatcctcggccctggcaggggaccagccgtcttccacc
gccttcatccctctcatatcaacccgagtgtctcttcggaaaacccgccagcctccagag
cggatcgccagcggcgccatcaccaagggcgtggtcctggacagcaccgaggcgctgtgc
ctcgccatctctaggaactccgagcagatggccagccacagcgcagtgctggaggccggc
aaaaacctctacacgttctgcgtgagctatgtggattccatccagcaaatgaggaacaag
tttgccttccgagaggccatcaacaaactggagaataatctccgggagcttcagatctgc
ccggcgacagcaggcagtggtccagcggccactcaggacttcagcaagctcctcagttcg
gtgaaggaaatcagtgacatagtgcagaggtag

DBGET integrated database retrieval system