KEGG   Homo sapiens (human): 26578
Entry
26578             CDS       T01001                                 
Symbol
OSTF1, OSF, SH3P2, bA235O14.1
Name
(RefSeq) osteoclast stimulating factor 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 SH3_1 SH3_9 SH3_2 Ank Ank_3
Other DBs
NCBI-GeneID: 26578
NCBI-ProteinID: NP_036515
OMIM: 610180
HGNC: 8510
Ensembl: ENSG00000134996
Pharos: Q92882(Tbio)
UniProt: Q92882
Structure
Position
9:75088514..75147265
AA seq 214 aa
MSKPPPKPVKPGQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGL
IPSNYVAEQAESIDNPLHEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGGHKD
IVEMLFTQPNIELNQQNKLGDTALHAAAWKGYADIVQLLLAKGARTDLRNIEKKLAFDMA
TNAACASLLKKKQGTDAVRTLSNAEDYLDDEDSD
NT seq 645 nt   +upstreamnt  +downstreamnt
atgtcgaagccgccacccaaaccagtcaaaccagggcaagttaaagtcttcagagccctg
tatacgtttgaacccagaactccagatgaattatactttgaggaaggtgatattatctac
attactgacatgagcgataccaattggtggaaaggcacctccaaaggcaggactggacta
attccaagcaactatgtggctgagcaggcagaatccattgacaatccattgcatgaagca
gcaaaaagaggcaacttgagctggttgagagagtgtttggacaacagagtgggtgttaat
ggcttagacaaagctggaagcactgccttatactgggcttgccacgggggccacaaagat
atagtggaaatgctatttactcaaccaaatattgaactgaaccagcagaacaagttggga
gatacagctttgcatgctgctgcctggaagggttatgcagatatcgtccagttgcttctg
gcaaaaggtgctagaacagacttaagaaacattgagaagaagctggccttcgacatggct
accaatgctgcctgtgcatctctcctgaaaaagaaacagggaacagatgcagttcgaaca
ttaagcaatgccgaggactatctcgatgatgaagactcagattaa

DBGET integrated database retrieval system