KEGG   Homo sapiens (human): 27Help
Entry
27                CDS       T01001                                 

Gene name
ABL2, ABLL, ARG
Definition
(RefSeq) ABL proto-oncogene 2, non-receptor tyrosine kinase
  KO
K08887  abelson tyrosine-protein kinase 2 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    27 (ABL2)
   04012 ErbB signaling pathway
    27 (ABL2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    27 (ABL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    27 (ABL2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     27 (ABL2)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  ABL family
   27 (ABL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase F_actin_bind SH2 SH3_1 SH3_9 SH3_2 SH3_3 Haspin_kinase NHS SH3_6 RGS12_us1
Motif
Other DBs
NCBI-GeneID: 27
NCBI-ProteinID: NP_009298
OMIM: 164690
HGNC: 77
Ensembl: ENSG00000143322
Vega: OTTHUMG00000035199
Pharos: P42684(Tchem)
UniProt: P42684
Structure
PDB: 

Position
1q25.2
AA seq 1182 aa AA seqDB search
MGQQVGRVGEAPGLQQPQPRGIRGSSAARPSGRRRDPAGRTTETGFNIFTQHDHFASCVE
DGFEGDKTGGSSPEALHRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVA
SGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSR
SAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTADGKVYVTAESRFST
LAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYG
EVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIV
TEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGEN
HVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIAT
YGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFE
TMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATE
NSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKR
NAPTPPKRSSSFREMENQPHKKYELTGNFSSVASLQHADGFSFTPAQQEANLVPPKCYGG
SFAQRNLCNDDGGGGGGSGTAGGGWSGITGFFTPRLIKKTLGLRAGKPTASDDTSKPFPR
SNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEES
AAPSRERPKAKLLPRGATALPLRTPSGDLAITEKDPPGVGVAGVAAAPKGKEKNGGARLG
MAGVPEDGEQPGWPSPAKAAPVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKL
LSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQHPSICSDPTEEPTALTAGQSTSETQE
GGKKAALGAVPISGKAGRPVMPPPQVPLPTSSISPAKMANGTAGTKVALRKTKQAAEKIS
ADKISKEALLECADLLSSALTEPVPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFAFREAV
SKLELSLQELQVSSAAAGVPGTNPVLNNLLSCVQEISDVVQR
NT seq 3549 nt NT seq  +upstreamnt  +downstreamnt
atggggcagcaggtgggccgcgtcggggaagctccggggctccagcagcctcagccccgc
gggatccggggcagcagtgcagccaggccctccggccgcaggcgggacccggcggggcgc
accacagagaccggcttcaatatcttcacccagcatgatcactttgccagctgtgtggag
gatggatttgagggagacaagactggaggcagtagtccagaagctttgcatcgtccctat
ggttgtgatgttgaaccccaggcactaaatgaggctatcaggtggagctccaaggagaac
ttgctcggagccactgagagtgaccctaatctcttcgttgcactttatgattttgtagca
agtggtgataacacactcagcatcactaaaggtgaaaagctacgagtccttggttacaac
cagaatggtgagtggagtgaagttcgctctaagaatgggcagggctgggtgccaagcaac
tacatcaccccagtgaacagcctggaaaaacactcctggtaccatggacctgtgtcacgc
agtgcagctgagtatctgctcagcagtctaatcaatggcagcttcctggtgcgagaaagt
gagagtagccctgggcagctgtccatctcgctcaggtacgagggacgtgtgtatcactac
aggatcaataccactgcagatggcaaggtgtatgtgactgctgagagccgcttcagcacc
ttggcagagcttgtacaccatcactccacagtggctgatgggctggtgacaacattacac
tacccagcacccaagtgtaataagcctacagtctatggtgtgtcccccatccacgacaaa
tgggaaatggagcgaacagatattaccatgaagcacaaacttgggggcggtcagtatgga
gaggtttacgttggcgtctggaagaaatacagccttacagttgctgtgaaaacattgaag
gaagataccatggaggtagaagaattcctgaaagaagctgcagtaatgaaggaaatcaag
catcctaatctggtacaacttttaggtgtgtgtactttggagccaccattttacattgtg
actgaatacatgccatacgggaatttgctggattacctccgagaatgcaaccgagaagag
gtgactgcagttgtgctgctctacatggccactcagatttcttctgcaatggagtactta
gagaagaagaatttcatccatagagatcttgcagctcgtaactgcctagtgggagaaaac
catgtggtaaaagtggctgactttggcttaagtagattgatgactggagacacttatact
gctcatgctggagccaaatttcctattaagtggacagcaccagagagtcttgcctacaat
accttctcaattaaatctgacgtctgggcttttggggtattgttgtgggaaattgctacc
tatggaatgtcaccatatccaggtattgacctgtctcaggtctatgacctactagaaaaa
ggatatcgaatggaacagcctgagggatgcccccctaaggtttatgaacttatgagagca
tgctggaagtggagccctgccgataggccctcttttgctgaaacacaccaagcttttgaa
accatgttccatgactccagcatttctgaagaggtagctgaggagcttgggagagccgcc
tcctcgtcatctgttgttccatacctgccccggctacctatacttccttccaagactcgg
acactgaagaaacaggtggagaacaaggagaacattgaaggggcacaagatgccacagaa
aattctgcttccagtttagcaccagggttcatcagaggtgcacaggcctctagtggatcc
ccagcactgcctcgaaagcaaagagacaagtcacccagcagcctcttggaagatgccaaa
gagacatgcttcaccagggataggaaggggggcttcttcagctccttcatgaagaagaga
aatgctcctacaccccccaaacgcagcagctccttccgagaaatggagaatcagccccat
aagaaatacgaactcacgggtaacttctcatctgttgcttctctacagcatgctgatggg
ttctctttcactcctgcccagcaagaggcgaatctggtgccacccaagtgctatgggggg
agctttgcacagaggaacctctgtaatgacgacggtggtgggggtgggggcagtggcact
gctgggggtgggtggtctggcatcacaggcttctttacaccacgcttaatcaaaaagaca
ctgggcttacgagcaggtaaacccacagccagtgatgacacttccaagccttttccaagg
tcaaactctacatcttccatgtcctcagggcttccagagcaggataggatggcaatgacc
cttcccaggaactgccagaggtccaaactccagctggaaaggacagtgtccacctcttct
cagccagaagagaatgtggacagggccaatgacatgcttccaaaaaaatcagaggaaagt
gctgctccaagcagggagagaccaaaagccaagttattgcccagaggagccacagctctt
cctctcagaacaccctctggggatctagccattacagagaaggaccctccaggggtggga
gtggctggagtggcagctgcccccaagggtaaagagaagaatggtggggcacgacttggg
atggctggagttccagaggatggagagcagccgggctggccttctccagccaaggctgcc
cccgtcctcccaaccactcacaaccacaaagtgccagtccttatctcacccactctgaaa
cacactccagctgacgtgcagctcattggcacagactctcaggggaataaattcaagctc
ttatctgagcatcaggtcacatcctctggagacaaggaccgaccccgacgggtaaaacca
aagtgtgccccacccccaccaccagtgatgagactactgcagcatccgtccatctgctca
gaccctacagaagagccaactgccctaactgcaggacagtccacatcagaaacacaggaa
ggaggaaagaaggcagctctgggcgcagtgcccatcagtgggaaagctgggaggccagtg
atgcctccacctcaagtgcctctgcccacatcttccatctcgccagccaaaatggccaat
ggcacagcaggtactaaagtggctctgagaaaaaccaaacaggccgctgagaaaatctca
gcagacaaaatcagcaaagaggccctgctggaatgtgctgacctactgtccagtgcactc
acggaacctgtgcccaacagccagctggtagacactggacaccagctgcttgactactgc
tcaggctatgtggactgcatccctcaaactcgcaacaaatttgccttccgagaggctgtg
agcaaactggaactcagcctgcaggagctacaggtttcttcagcagctgctggtgtgccc
gggacaaaccctgtccttaataacttattgtcatgtgtacaggaaatcagtgatgtggtg
cagaggtag

DBGET integrated database retrieval system