KEGG   Homo sapiens (human): 2775Help
Entry
2775              CDS       T01001                                 

Gene name
GNAO1, EIEE17, G-ALPHA-o, GNAO, HLA-DQB1, NEDIM
Definition
(RefSeq) G protein subunit alpha o1
  KO
K04534  guanine nucleotide-binding protein G(o) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04921  Oxytocin signaling pathway
hsa04926  Relaxin signaling pathway
hsa05032  Morphine addiction
hsa05034  Alcoholism
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05163  Human cytomegalovirus infection
Network
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
Disease
H00606  Early infantile epileptic encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    2775 (GNAO1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    2775 (GNAO1)
   04921 Oxytocin signaling pathway
    2775 (GNAO1)
   04926 Relaxin signaling pathway
    2775 (GNAO1)
   04916 Melanogenesis
    2775 (GNAO1)
  09156 Nervous system
   04724 Glutamatergic synapse
    2775 (GNAO1)
   04727 GABAergic synapse
    2775 (GNAO1)
   04725 Cholinergic synapse
    2775 (GNAO1)
   04728 Dopaminergic synapse
    2775 (GNAO1)
   04726 Serotonergic synapse
    2775 (GNAO1)
   04730 Long-term depression
    2775 (GNAO1)
   04723 Retrograde endocannabinoid signaling
    2775 (GNAO1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2775 (GNAO1)
 09160 Human Diseases
  09164 Substance dependence
   05032 Morphine addiction
    2775 (GNAO1)
   05034 Alcoholism
    2775 (GNAO1)
  09167 Infectious diseases
   05163 Human cytomegalovirus infection
    2775 (GNAO1)
   05145 Toxoplasmosis
    2775 (GNAO1)
   05142 Chagas disease (American trypanosomiasis)
    2775 (GNAO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2775 (GNAO1)
   04031 GTP-binding proteins [BR:hsa04031]
    2775 (GNAO1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2775 (GNAO1)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    2775 (GNAO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB DUF685 AAA_29
Motif
Other DBs
NCBI-GeneID: 2775
NCBI-ProteinID: NP_066268
OMIM: 139311
HGNC: 4389
Ensembl: ENSG00000087258
Vega: OTTHUMG00000133241
Pharos: P09471(Tbio)
UniProt: P09471 B3KP89 Q8N6I9
Structure
PDB: 

Position
16q13
AA seq 354 aa AA seqDB search
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDG
FSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF
SAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRV
KTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDET
TNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDA
AAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggatgtactctgagcgcagaggagagagccgccctcgagcggagcaaggcgattgag
aaaaacctcaaagaggatggcatcagcgccgccaaagacgtgaaattactcctgctcggg
gctggagaatcaggaaaaagcaccattgtgaagcagatgaagatcatccatgaagatggc
ttctccggagaagacgtgaaacagtacaagcctgttgtctacagcaacactatccagtcc
ctggcagccatcgtccgggccatggacactttgggcatcgaatatggtgataaggagaga
aaggctgacgccaagatggtgtgtgatgtggtgagtcggatggaagacaccgagcccttc
tctgcagagctgctttctgccatgatgcggctctggggcgactcaggaatccaagagtgc
ttcaaccggtcccgggagtatcagctcaacgactctgccaaatactacctggacagcctg
gatcggattggggccgccgactaccagcccaccgagcaggacatcctccgaaccagggtc
aaaaccactggcatcgtagaaacccacttcacattcaagaacctccacttcaggctgttt
gacgtcggaggccagcgatctgaacgcaagaagtggatccattgcttcgaggacgtcacg
gccatcattttctgtgtcgcgctcagcggctatgaccaggtgctccacgaagacgaaacc
acgaaccgcatgcacgagtctctcatgctcttcgactccatctgtaacaacaagttcttc
atcgatacctccatcattctcttcctcaacaagaaagatctctttggcgagaagatcaag
aagtcacctttgaccatctgctttcctgaatacacaggccccaatacctatgaagacgca
gccgcctacatccaagcacaatttgaaagcaaaaaccgctcacccaacaaagaaatatat
tgtcacatgacttgtgccacagacacgaataacatccaggtggtgttcgacgccgtcacc
gacatcatcattgccaacaacctccggggctgcggcttgtactga

DBGET integrated database retrieval system