KEGG   Homo sapiens (human): 2776Help
Entry
2776              CDS       T01001                                 

Gene name
GNAQ, CMC1, G-ALPHA-q, GAQ, SWS
Definition
(RefSeq) G protein subunit alpha q
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa05010  Alzheimer disease
hsa05016  Huntington disease
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05146  Amoebiasis
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
Network
N00291  CaSR-PTH signaling pathway
N00292  Mutation-inactivated CASR to CasR-PTH signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
N00407  HCMV UL33 to GNAQ-PLCB/G-calcineurin signaling pathway
Disease
H01809  Sturge-Weber syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    2776 (GNAQ)
   04371 Apelin signaling pathway
    2776 (GNAQ)
   04020 Calcium signaling pathway
    2776 (GNAQ)
   04071 Sphingolipid signaling pathway
    2776 (GNAQ)
   04022 cGMP - PKG signaling pathway
    2776 (GNAQ)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    2776 (GNAQ)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    2776 (GNAQ)
  09152 Endocrine system
   04911 Insulin secretion
    2776 (GNAQ)
   04922 Glucagon signaling pathway
    2776 (GNAQ)
   04912 GnRH signaling pathway
    2776 (GNAQ)
   04915 Estrogen signaling pathway
    2776 (GNAQ)
   04921 Oxytocin signaling pathway
    2776 (GNAQ)
   04918 Thyroid hormone synthesis
    2776 (GNAQ)
   04928 Parathyroid hormone synthesis, secretion and action
    2776 (GNAQ)
   04916 Melanogenesis
    2776 (GNAQ)
   04924 Renin secretion
    2776 (GNAQ)
   04925 Aldosterone synthesis and secretion
    2776 (GNAQ)
   04927 Cortisol synthesis and secretion
    2776 (GNAQ)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    2776 (GNAQ)
   04270 Vascular smooth muscle contraction
    2776 (GNAQ)
  09154 Digestive system
   04970 Salivary secretion
    2776 (GNAQ)
   04971 Gastric acid secretion
    2776 (GNAQ)
   04972 Pancreatic secretion
    2776 (GNAQ)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    2776 (GNAQ)
  09156 Nervous system
   04724 Glutamatergic synapse
    2776 (GNAQ)
   04725 Cholinergic synapse
    2776 (GNAQ)
   04728 Dopaminergic synapse
    2776 (GNAQ)
   04726 Serotonergic synapse
    2776 (GNAQ)
   04720 Long-term potentiation
    2776 (GNAQ)
   04730 Long-term depression
    2776 (GNAQ)
   04723 Retrograde endocannabinoid signaling
    2776 (GNAQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    2776 (GNAQ)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2776 (GNAQ)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    2776 (GNAQ)
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    2776 (GNAQ)
   05016 Huntington disease
    2776 (GNAQ)
  09166 Endocrine and metabolic diseases
   04934 Cushing syndrome
    2776 (GNAQ)
  09167 Infectious diseases
   05163 Human cytomegalovirus infection
    2776 (GNAQ)
   05146 Amoebiasis
    2776 (GNAQ)
   05142 Chagas disease (American trypanosomiasis)
    2776 (GNAQ)
   05143 African trypanosomiasis
    2776 (GNAQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2776 (GNAQ)
   04031 GTP-binding proteins [BR:hsa04031]
    2776 (GNAQ)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2776 (GNAQ)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    2776 (GNAQ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA AAA_29
Motif
Other DBs
NCBI-GeneID: 2776
NCBI-ProteinID: NP_002063
OMIM: 600998
HGNC: 4390
Ensembl: ENSG00000156052
Vega: OTTHUMG00000020059
Pharos: P50148(Tbio)
UniProt: P50148 A0A024R240
Position
9q21.2
AA seq 359 aa AA seqDB search
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactctggagtccatcatggcgtgctgcctgagcgaggaggccaaggaagcccggcgg
atcaacgacgagatcgagcggcagctccgcagggacaagcgggacgcccgccgggagctc
aagctgctgctgctcgggacaggagagagtggcaagagtacgtttatcaagcagatgaga
atcatccatgggtcaggatactctgatgaagataaaaggggcttcaccaagctggtgtat
cagaacatcttcacggccatgcaggccatgatcagagccatggacacactcaagatccca
tacaagtatgagcacaataaggctcatgcacaattagttcgagaagttgatgtggagaag
gtgtctgcttttgagaatccatatgtagatgcaataaagagtttatggaatgatcctgga
atccaggaatgctatgatagacgacgagaatatcaattatctgactctaccaaatactat
cttaatgacttggaccgcgtagctgaccctgcctacctgcctacgcaacaagatgtgctt
agagttcgagtccccaccacagggatcatcgaatacccctttgacttacaaagtgtcatt
ttcagaatggtcgatgtagggggccaaaggtcagagagaagaaaatggatacactgcttt
gaaaatgtcacctctatcatgtttctagtagcgcttagtgaatatgatcaagttctcgtg
gagtcagacaatgagaaccgaatggaggaaagcaaggctctctttagaacaattatcaca
tacccctggttccagaactcctcggttattctgttcttaaacaagaaagatcttctagag
gagaaaatcatgtattcccatctagtcgactacttcccagaatatgatggaccccagaga
gatgcccaggcagcccgagaattcattctgaagatgttcgtggacctgaacccagacagt
gacaaaattatctactcccacttcacgtgcgccacagacaccgagaatatccgctttgtc
tttgctgccgtcaaggacaccatcctccagttgaacctgaaggagtacaatctggtctaa

DBGET integrated database retrieval system