KEGG   Homo sapiens (human): 282808
Entry
282808            CDS       T01001                                 
Symbol
RAB40AL, MRXSMP, RAR2, RLGP
Name
(RefSeq) RAB40A like
  KO
K07928  Ras-related protein Rab-40
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    282808 (RAB40AL)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    282808 (RAB40AL)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul5 complex
    Target recognizing subunit
     282808 (RAB40AL)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab40
    282808 (RAB40AL)
SSDB
Motif
Pfam: Ras Roc Arf SOCS_box MMR_HSR1
Other DBs
NCBI-GeneID: 282808
NCBI-ProteinID: NP_001027004
OMIM: 300405
HGNC: 25410
Ensembl: ENSG00000102128
Pharos: P0C0E4(Tdark)
UniProt: P0C0E4
Position
X:102937272..102938300
AA seq 278 aa
MSAPGSPDQAYDFLLKFLLVGDRDVGKSEILESLQDGTAESPYSHLGGIDYKTTTILLDG
QRVKLKLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFEGMDRWIKKIEEHAPGVP
KILVGNRLHLAFKRQVPREQAQAYAERLGVTFFEVSPLCNFNIIESFTELARIVLLRHRL
NWLGRPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPIALRSHLKSFSMAKGLNARMMRGLS
YSLTTSSTHKRSSLCKVKIVCPPQSPPKNCTRNSCKIS
NT seq 837 nt   +upstreamnt  +downstreamnt
atgagcgccccgggcagccccgaccaggcctacgacttcctgctcaagttcctgctggtg
ggcgacagggacgtaggcaagagtgagatcctggagagcctgcaggacggcacggccgag
tccccgtacagtcacctggggggaatcgactacaagacgaccaccatcctgctggacggc
cagcgggtgaagctgaagctctgggatacgtcggggcagggaagattttgtaccatattc
cgctcctactctcgtggtgcacaaggagtgatcctggtctacgacattgcaaaccgctgg
tctttcgagggtatggatcgatggattaagaagattgaggaacatgcccctggtgtccct
aaaatcctggtggggaatcgcctacatctggcattcaagaggcaggtgcccagggagcag
gcccaggcctacgccgagcgcctgggcgtgaccttctttgaggtcagccctctgtgcaat
ttcaacatcatagagtctttcacggagctggccaggatagtgctgctgcggcacaggttg
aactggctcgggaggccgagcaaggtactgagcttgcaagacctctgctgccgcaccatc
gtgtcctgcacacctgtgcatctggtggacaagctcccgctccccattgccttaagaagc
cacctcaagtccttctccatggctaagggcctgaatgccaggatgatgcgaggcctctcc
tactccctcaccaccagctccactcacaaaaggagcagcctctgcaaagtgaagatcgtc
tgcccaccccagagcccacccaaaaactgcaccagaaacagctgcaaaatttcttaa

DBGET integrated database retrieval system