KEGG   Homo sapiens (human): 28511
Entry
28511             CDS       T01001                                 
Symbol
NKIRAS2, KBRAS2, kappaB-Ras2
Name
(RefSeq) NFKB inhibitor interacting Ras like 2
  KO
K17197  NF-kappa-B inhibitor-interacting Ras-like protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    28511 (NKIRAS2)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Ras Family
   Nki-Ras
    28511 (NKIRAS2)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU Dynamin_N DUF2121 RsgA_GTPase nSTAND3 AAA_16 DUF2677 UPF0113
Other DBs
NCBI-GeneID: 28511
NCBI-ProteinID: NP_001001349
OMIM: 604497
HGNC: 17898
Ensembl: ENSG00000168256
UniProt: Q9NYR9
Position
17:42017576..42025641
AA seq 191 aa
MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFY
DTRGLRDGAELPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGN
KCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLS
RKNKGSGSLDG
NT seq 576 nt   +upstreamnt  +downstreamnt
atggggaagagctgcaaggtggtcgtgtgtggccaggcgtctgtgggcaaaacttcaatc
ctggagcagcttctgtatgggaaccatgtagtgggttcggagatgatcgagacgcaggag
gacatctacgtgggctccattgagacagaccggggggtgcgagagcaggtgcgtttctat
gacacccgggggctccgagatggggccgaactgccccgacactgcttctcttgcactgat
ggctacgtcctggtctatagcacagatagcagagagtcttttcagcgtgtggagctgctc
aagaaggagattgacaaatccaaggacaagaaggaggtcaccatcgtggtccttggcaac
aagtgtgacttacaggagcagcggcgtgtagacccagatgtggctcagcactgggccaag
tcagagaaggtgaagctgtgggaggtgtcagtggcggaccggcgctccctcctggagccc
tttgtctacttggccagcaagatgacgcaaccccagagcaagtctgccttccccctcagc
cggaagaacaagggcagcggctccttggatggctga

DBGET integrated database retrieval system