KEGG   Homo sapiens (human): 28512
Entry
28512             CDS       T01001                                 

Gene name
NKIRAS1, KBRAS1, kappaB-Ras1
Definition
(RefSeq) NFKB inhibitor interacting Ras like 1
  KO
K17197  NF-kappa-B inhibitor-interacting Ras-like protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    28512 (NKIRAS1)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Ras Family
   Nki-Ras
    28512 (NKIRAS1)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 cobW DUF89 DUF2121
Other DBs
NCBI-GeneID: 28512
NCBI-ProteinID: NP_065078
OMIM: 604496
HGNC: 17899
Ensembl: ENSG00000197885
Vega: OTTHUMG00000155605
Pharos: Q9NYS0(Tbio)
UniProt: Q9NYS0
Position
3p24.2
AA seq 192 aa
MGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQLHLY
DTRGLQEGVELPKHYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGN
KIDLSEQRQVDAEVAQQWAKSEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLP
GRKNKGNSNSEN
NT seq 579 nt   +upstreamnt  +downstreamnt
atgggaaagggctgcaaggttgtggtttgtggattgttatctgtggggaaaactgcaatt
ttggagcagctcctttatggaaatcatactattggaatggaagattgcgaaacaatggaa
gatgtatacatggcttcagtagaaacagaccgaggagtaaaagaacagttacatctttat
gacaccagaggtctacaggaaggcgtggagctgccaaagcattatttttcatttgctgat
ggcttcgttcttgtgtacagtgtgaataaccttgaatcctttcaaagagtggagcttctg
aagaaagaaatcgataagttcaaagacaaaaaagaggtagcaattgtggtattaggaaac
aaaatcgacctttctgagcagagacaagtggacgctgaagtggcacagcagtgggcaaaa
agtgagaaagtaagactgtgggaggtgactgttacagatcggaaaactctgattgaacca
ttcactttattagccagtaaactttctcaaccccagagcaaatcaagctttcctttgcct
gggaggaaaaacaaagggaactctaattctgagaactaa

DBGET integrated database retrieval system