KEGG   Homo sapiens (human): 30008Help
Entry
30008             CDS       T01001                                 

Gene name
EFEMP2, ARCL1B, FBLN4, MBP1, UPH1
Definition
(RefSeq) EGF containing fibulin extracellular matrix protein 2
  KO
K19866  EGF-containing fibulin-like extracellular matrix protein 2
Organism
hsa  Homo sapiens (human)
Disease
H00557  Cutis laxa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    30008 (EFEMP2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   30008 (EFEMP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF_CA cEGF FXa_inhibition EGF_3 EGF hEGF Adipogenin
Motif
Other DBs
NCBI-GeneID: 30008
NCBI-ProteinID: NP_058634
OMIM: 604633
HGNC: 3219
Ensembl: ENSG00000172638
Vega: OTTHUMG00000166664
Pharos: O95967(Tbio)
UniProt: O95967 A0A024R5G1 Q9H3D5
Structure
PDB: 

Position
11q13.1
AA seq 443 aa AA seqDB search
MLPCASCLPGSLLLWALLLLLLGSASPQDSEEPDSYTECTDGYEWDPDSQHCRDVNECLT
IPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDS
CVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNL
PGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYGTFLCRCHQGYELHRDGFS
CSDIDECSYSSYLCQYRCINEPGRFSCHCPQGYQLLATRLCQDIDECESGAHQCSEAQTC
VNFHGGYRCVDTNRCVEPYIQVSENRCLCPASNPLCREQPSSIVHRYMTITSERSVPADV
FQIQATSVYPGAYNAFQIRAGNSQGDFYIRQINNVSAMLVLARPVTGPREYVLDLEMVTM
NSLMSYRASSVLRLTVFVGAYTF
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgctcccctgcgcctcctgcctacccgggtctctactgctctgggcgctgctactgttg
ctcttgggatcagcttctcctcaggattctgaagagcccgacagctacacggaatgcaca
gatggctatgagtgggacccagacagccagcactgccgggatgtcaacgagtgtctgacc
atccctgaggcctgcaagggggaaatgaagtgcatcaaccactacgggggctacttgtgc
ctgccccgctccgctgccgtcatcaacgacctacacggcgagggacccccgccaccagtg
cctcccgctcaacaccccaacccctgcccaccaggctatgagcccgacgatcaggacagc
tgtgtggatgtggacgagtgtgcccaggccctgcacgactgtcgccccagccaggactgc
cataacttgcctggctcctatcagtgcacctgccctgatggttaccgcaagatcgggccc
gagtgtgtggacatagacgagtgccgctaccgctactgccagcaccgctgcgtgaacctg
cctggctccttccgctgccagtgcgagccgggcttccagctggggcctaacaaccgctcc
tgtgttgatgtgaacgagtgtgacatgggggccccatgcgagcagcgctgcttcaactcc
tatgggaccttcctgtgtcgctgccaccagggctatgagctgcatcgggatggcttctcc
tgcagtgatattgatgagtgtagctactccagctacctctgtcagtaccgctgcatcaac
gagccaggccgtttctcctgccactgcccacagggttaccagctgctggccacacgcctc
tgccaagacattgatgagtgtgagtctggtgcgcaccagtgctccgaggcccaaacctgt
gtcaacttccatgggggctaccgctgcgtggacaccaaccgctgcgtggagccctacatc
caggtctctgagaaccgctgtctctgcccggcctccaaccctctatgtcgagagcagcct
tcatccattgtgcaccgctacatgaccatcacctcggagcggagcgtgcccgctgacgtg
ttccagatccaggcgacctccgtctaccccggtgcctacaatgcctttcagatccgtgct
ggaaactcgcagggggacttttacattaggcaaatcaacaacgtcagcgccatgctggtc
ctcgcccggccggtgacgggcccccgggagtacgtgctggacctggagatggtcaccatg
aattccctcatgagctaccgggccagctctgtactgaggctcaccgtctttgtaggggcc
tacaccttctga

DBGET integrated database retrieval system