KEGG   Homo sapiens (human): 3093Help
Entry
3093              CDS       T01001                                 

Gene name
UBE2K, E2-25K, HIP2, HYPG, LIG, UBC1
Definition
(RefSeq) ubiquitin conjugating enzyme E2 K
  KO
K04649  ubiquitin-conjugating enzyme (huntingtin interacting protein 2) [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    3093 (UBE2K)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    3093 (UBE2K)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     3093 (UBE2K)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   3093 (UBE2K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con UBA Prok-E2_B RWD UEV UBA_3 UFC1
Motif
Other DBs
NCBI-GeneID: 3093
NCBI-ProteinID: NP_005330
OMIM: 602846
HGNC: 4914
Ensembl: ENSG00000078140
Vega: OTTHUMG00000160543
Pharos: P61086(Tbio)
UniProt: P61086
Structure
PDB: 

Position
4p14
AA seq 200 aa AA seqDB search
MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEI
KIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAA
EPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVI
VALSSKSWDVETATELLLSN
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggccaacatcgcggtgcagcgaatcaagcgggagttcaaggaggtgctgaagagcgag
gagacgagcaaaaatcaaattaaagtagatcttgtagatgagaattttacagaattaaga
ggagaaatagcaggacctccagacacaccatatgaaggaggaagataccaactagagata
aaaataccagaaacatacccatttaatccccctaaggtccggtttatcactaaaatatgg
catcctaatattagttccgtcacaggggctatttgtttggatatcctgaaagatcaatgg
gcagctgcaatgactctccgcacggtattattgtcattgcaagcactattggcagctgca
gagccagatgatccacaggatgctgtagtagcaaatcagtacaaacaaaatcccgaaatg
ttcaaacagacagctcgactttgggcacatgtgtatgctggagcaccagtttctagtcca
gaatacaccaaaaaaatagaaaacctatgtgctatgggctttgataggaatgcagtaata
gtggccttgtcttcaaaatcatgggatgtagagactgcaacagaattgcttctgagtaac
tga

DBGET integrated database retrieval system