KEGG   Homo sapiens (human): 338328Help
Entry
338328            CDS       T01001                                 

Gene name
GPIHBP1, GPI-HBP1, HYPL1D
Definition
(RefSeq) glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1
  KO
K20001  glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1
Organism
hsa  Homo sapiens (human)
Disease
H00154  Hyperlipoproteinemia, type I
H01784  Primary hyperchylomicronemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    338328 (GPIHBP1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  338328 (GPIHBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPAR_LY6 CENP-B_dimeris Dickkopf_N UPAR_LY6_2 PBP1_TM DNA_pol_phi
Motif
Other DBs
NCBI-GeneID: 338328
NCBI-ProteinID: NP_835466
OMIM: 612757
HGNC: 24945
Ensembl: ENSG00000277494
Vega: OTTHUMG00000164950
Pharos: Q8IV16(Tbio)
UniProt: Q8IV16
Structure
PDB: 

Position
8q24.3
AA seq 184 aa AA seqDB search
MKALGAVLLALLLFGRPGRGQTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSR
VLLRCYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKT
VEGTQVTMTCCQSSLCNVPPWQSSRVQDPTGKGAGGPRGSSETVGAALLLNLLAGLGAMG
ARRP
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgctcggggctgtcctgcttgccctcttgctgttcgggcggccagggagaggg
cagacacagcaggaggaagaggaagaggacgaggaccacgggccagatgactacgacgag
gaagatgaggatgaggtggaagaggaggagaccaacaggctccctggtggcaggagcaga
gtgctgctgcggtgctacacctgcaagtccctgcccagggacgagcgctgcaacctgacg
cagaactgctcacatggccagacctgcacaaccctcattgcccacgggaacaccgagtca
ggcctcctgaccacccactccacgtggtgcacagacagctgccagcccatcaccaagacg
gtggaggggacccaggtgaccatgacctgctgccagtccagcctgtgcaatgtcccaccc
tggcaaagctcccgagtccaggacccaacaggcaagggggcaggcggcccccggggcagc
tccgaaactgtgggcgcagccctcctgctcaacctccttgccggccttggagcaatgggg
gccaggagaccctga

DBGET integrated database retrieval system