KEGG   Homo sapiens (human): 346562Help
Entry
346562            CDS       T01001                                 

Gene name
GNAT3, GDCA
Definition
(RefSeq) G protein subunit alpha transducin 3
  KO
K19729  guanine nucleotide-binding protein G(t) subunit alpha 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
hsa04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    346562 (GNAT3)
  Sensory system
   04742 Taste transduction
    346562 (GNAT3)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    346562 (GNAT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 DAP3
Motif
Other DBs
NCBI-GeneID: 346562
NCBI-ProteinID: NP_001095856
OMIM: 139395
HGNC: 22800
Ensembl: ENSG00000214415
Vega: OTTHUMG00000155401
Pharos: A8MTJ3(Tbio)
UniProt: A8MTJ3
Position
7q21.11
AA seq 354 aa AA seqDB search
MGSGISSESKESAKRSKELEKKLQEDAERDARTVKLLLLGAGESGKSTIVKQMKIIHKNG
YSEQECMEFKAVIYSNTLQSILAIVKAMTTLGIDYVNPRSAEDQRQLYAMANTLEDGGMT
PQLAEVIKRLWRDPGIQACFERASEYQLNDSAAYYLNDLDRITASGYVPNEQDVLHSRVK
TTGIIETQFSFKDLHFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDEEV
NRMHESLHLFNSICNHKYFSTTSIVLFLNKKDIFQEKVTKVHLSICFPEYTGPNTFEDAG
NYIKNQFLDLNLKKEDKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtggaattagttcagagagcaaggagtcagccaaaagatcaaaagaactggag
aaaaagcttcaggaggatgctgagcgagatgcaagaaccgtaaagctgctactattagga
gcaggagaatctgggaaaagtactattgttaaacaaatgaagatcatccataagaatggt
tacagtgagcaagaatgcatggagttcaaagcagtaatttacagtaatacattgcaatcc
atcctagctattgtgaaagccatgactacccttggaattgattatgtaaatcccagaagt
gcagaggaccaacgacaactttatgcaatggcaaataccctggaagatggtggcatgaca
cctcaactggctgaggtaataaaacggctgtggagagatccaggaattcaggcctgcttt
gaaagggcatctgaatatcagctcaatgactcagcagcttactaccttaatgatttagat
agaataacagcatctgggtatgtgccaaatgaacaagatgttctccattctcgagtgaaa
acgactggaatcattgaaactcaattctcctttaaagacttgcacttcaggatgtttgat
gtaggtggacagagatctgagagaaagaagtggattcactgctttgaaggagttacatgc
attatattttgtgctgcacttagtgcctatgacatggtcctcgtggaagacgaagaagtg
aatagaatgcatgaaagccttcacctgttcaacagtatctgtaatcacaagtatttttca
acaacctccattgtcctgttcctcaacaaaaaagatatctttcaagaaaaggtaaccaag
gtgcatcttagtatctgctttccagaatacactgggccaaatacatttgaagatgcagga
aactacatcaagaaccagtttctagacctgaatttaaaaaaagaagataaggaaatttat
tcccacatgacctgtgctactgacacccaaaatgtcaagtttgtgtttgacgcagttaca
gatataataatcaaagagaatctaaaagactgtgggcttttctaa

DBGET integrated database retrieval system