KEGG   Homo sapiens (human): 392509Help
Entry
392509            CDS       T01001                                 

Gene name
ARL13A, ARL13, dJ341D10.2
Definition
(RefSeq) ADP ribosylation factor like GTPase 13A
  KO
K07961  ADP-ribosylation factor-like protein 13
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    392509 (ARL13A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Others
    392509 (ARL13A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf SRPRB Roc G-alpha Ras AAA_15 MMR_HSR1 TniB AAA_29
Motif
Other DBs
NCBI-GeneID: 392509
NCBI-ProteinID: NP_001155963
HGNC: 31709
Ensembl: ENSG00000174225
Vega: OTTHUMG00000022013
Pharos: Q5H913(Tdark)
UniProt: Q5H913
Position
Xq22.1
AA seq 256 aa AA seqDB search
MFRLLSSCCSCLRTTEETRRNVTIPIIGLNNSGKTVLVEAFQKLLPSKTDHCMKSELTTL
LLDEYELSIYDLNGDLKGREAWPNYYAQAHGLVFVLDSSDIRRMQEVKIILTHLLSDKRV
AGKPILILANKQDKKKALMPCDIIDYLLLKKLVKENKCPCRVEPCSAIRNLERRNHQPIV
EGLRWLLAVIDTCQLPPTSSISISKNNTGSGERCSSHSFSTRTGMSKEKRQHLEQCSIEA
KPLKSILQPSNQSYTH
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgttccggcttttgtcctcctgctgctcttgcctaaggacaacagaagagacacgaagg
aatgtgaccatccctatcattggcttgaacaactctggcaaaactgttcttgtggaggca
ttccaaaaattacttcccagtaagacagaccattgcatgaaatcggaactgactacactt
ttgttagatgagtatgaactttccatctatgacctgaatggagacctgaagggccgggaa
gcatggccaaactactatgcacaggcccatgggcttgttttcgtcctggattccagtgac
ataagacgcatgcaggaagtgaagatcatcttaacacatctgctgtccgataaaagagtg
gcagggaaacccatcttaattttagcaaacaaacaagacaagaagaaagccctcatgcct
tgtgatattattgactatctacttctaaagaagctagtgaaagagaataagtgcccatgc
cgagtagagccatgttcagccatcagaaaccttgaaagaagaaaccatcagcccatagtt
gaaggactgcgctggctattagctgtcattgatacttgccaactaccacctacctcgagc
atctcaatctccaagaataacacaggctctggagaaagatgctcatcacacagcttctcc
accagaacaggaatgtcaaaggagaaaagacagcatctagaacaatgctcaatcgaagct
aagcctctaaagtcaatcctacagccatcaaatcaatcctatactcactga

DBGET integrated database retrieval system