KEGG   Homo sapiens (human): 43Help
Entry
43                CDS       T01001                                 

Gene name
ACHE, ACEE, ARACHE, N-ACHE, YT
Definition
(RefSeq) acetylcholinesterase (Cartwright blood group)
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa04725  Cholinergic synapse
Drug target
Acotiamide hydrochloride: D08838
Ambenonium (DG00990): D01001
Demecarium: D00667
Dimetacrine: D02565
Distigmine (DG00989): D01228
Donepezil (DG00983): D00670 D07869
Ecothiopate (DG01131): D02193
Edrophonium chloride: D00994
Fluostigmine: D00043
Galantamine (DG00985): D02173 D04292
Gallamine: D02292
Icopezil maleate: D03751
Ipidacrine: D09750
Itopride (DG01395): D02729 D08094
Ladostigil tartrate: D03239
Latrepirdine (DG01379): D09917 D09918
Neostigmine (DG00987): D00995 D00998 D08261
Obidoxime: D05215
Paraoxon: D10529
Physostigmine (DG01132): D00196 D02418 D03826
Pralidoxime (DG01153): D00469 D01572 D05590
Pyridostigmine (DG00988): D00487
Quilostigmine: D03823
Rivastigmine (DG00984): D02558 D03822
Suronacrine maleate: D05981
Tacrine (DG00982): D02068 D08555
Velnacrine maleate: D06288
Zanapezil fumarate: D09835
Zifrosilone: D06365
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    43 (ACHE)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    43 (ACHE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    43 (ACHE)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     43 (ACHE)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  43 (ACHE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase AChE_tetra Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 43
NCBI-ProteinID: NP_000656
OMIM: 100740
HGNC: 108
Ensembl: ENSG00000087085
Vega: OTTHUMG00000157033
Pharos: P22303(Tclin)
UniProt: P22303
Structure
PDB: 

Position
7q22.1
AA seq 614 aa AA seqDB search
MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPV
SAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSM
NYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASV
GMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTEL
VACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVG
VVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE
DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGY
EIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQ
YVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQDRCSDL
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccccgcagtgtctgctgcacacgccttccctggcttccccactccttctcctc
ctcctctggctcctgggtggaggagtgggggctgagggccgggaggatgcagagctgctg
gtgacggtgcgtgggggccggctgcggggcattcgcctgaagacccccgggggccctgtc
tctgctttcctgggcatcccctttgcggagccacccatgggaccccgtcgctttctgcca
ccggagcccaagcagccttggtcaggggtggtagacgctacaaccttccagagtgtctgc
taccaatatgtggacaccctatacccaggttttgagggcaccgagatgtggaaccccaac
cgtgagctgagcgaggactgcctgtacctcaacgtgtggacaccatacccccggcctaca
tcccccacccctgtcctcgtctggatctatgggggtggcttctacagtggggcctcctcc
ttggacgtgtacgatggccgcttcttggtacaggccgagaggactgtgctggtgtccatg
aactaccgggtgggagcctttggcttcctggccctgccggggagccgagaggccccgggc
aatgtgggtctcctggatcagaggctggccctgcagtgggtgcaggagaacgtggcagcc
ttcgggggtgacccgacatcagtgacgctgtttggggagagcgcgggagccgcctcggtg
ggcatgcacctgctgtccccgcccagccggggcctgttccacagggccgtgctgcagagc
ggtgcccccaatggaccctgggccacggtgggcatgggagaggcccgtcgcagggccacg
cagctggcccaccttgtgggctgtcctccaggcggcactggtgggaatgacacagagctg
gtagcctgccttcggacacgaccagcgcaggtcctggtgaaccacgaatggcacgtgctg
cctcaagaaagcgtcttccggttctccttcgtgcctgtggtagatggagacttcctcagt
gacaccccagaggccctcatcaacgcgggagacttccacggcctgcaggtgctggtgggt
gtggtgaaggatgagggctcgtattttctggtttacggggccccaggcttcagcaaagac
aacgagtctctcatcagccgggccgagttcctggccggggtgcgggtcggggttccccag
gtaagtgacctggcagccgaggctgtggtcctgcattacacagactggctgcatcccgag
gacccggcacgcctgagggaggccctgagcgatgtggtgggcgaccacaatgtcgtgtgc
cccgtggcccagctggctgggcgactggctgcccagggtgcccgggtctacgcctacgtc
tttgaacaccgtgcttccacgctctcctggcccctgtggatgggggtgccccacggctac
gagatcgagttcatctttgggatccccctggacccctctcgaaactacacggcagaggag
aaaatcttcgcccagcgactgatgcgatactgggccaactttgcccgcacaggggatccc
aatgagccccgagaccccaaggccccacaatggcccccgtacacggcgggggctcagcag
tacgttagtctggacctgcggccgctggaggtgcggcgggggctgcgcgcccaggcctgc
gccttctggaaccgcttcctccccaaattgctcagcgccaccgacacgctcgacgaggcg
gagcgccagtggaaggccgagttccaccgctggagctcctacatggtgcactggaagaac
cagttcgaccactacagcaagcaggatcgctgctcagacctgtga

DBGET integrated database retrieval system