KEGG   Homo sapiens (human): 4313Help
Entry
4313              CDS       T01001                                 

Gene name
MMP2, CLG4, CLG4A, MMP-2, MMP-II, MONA, TBE-1
Definition
(RefSeq) matrix metallopeptidase 2
  KO
K01398  matrix metalloproteinase-2 (gelatinase A) [EC:3.4.24.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04670  Leukocyte transendothelial migration
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05219  Bladder cancer
hsa05418  Fluid shear stress and atherosclerosis
Disease
H00025  Penile cancer
H00028  Choriocarcinoma
H00472  Multicentric osteolysis, nodulosis, and arthropathy (MONA)
Drug target
Batimastat: D03061
Ilomastat: D03793
Marimastat: D03795
Prinomastat: D03797
Rebimastat: D03800
Tanomastat: D03802
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    4313 (MMP2)
  Endocrine system
   04912 GnRH signaling pathway
    4313 (MMP2)
   04915 Estrogen signaling pathway
    4313 (MMP2)
   04926 Relaxin signaling pathway
    4313 (MMP2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4313 (MMP2)
   05205 Proteoglycans in cancer
    4313 (MMP2)
   05219 Bladder cancer
    4313 (MMP2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    4313 (MMP2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    4313 (MMP2)
  Drug resistance
   01522 Endocrine resistance
    4313 (MMP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.24  gelatinase A
     4313 (MMP2)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M10
   4313 (MMP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 Reprolysin_3 Reprolysin_5 Peptidase_M66 Reprolysin_4
Motif
Other DBs
NCBI-GeneID: 4313
NCBI-ProteinID: NP_004521
OMIM: 120360
HGNC: 7166
Ensembl: ENSG00000087245
Vega: OTTHUMG00000133202
Pharos: P08253(Tchem)
UniProt: P08253 A0A024R6R4
Structure
PDB: 

Position
16q12.2
AA seq 660 aa AA seqDB search
MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGT
SYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQ
IRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEY
WIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP
GFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgctaatggcccggggcgcgctcacgggtcccctgagggcgctctgtctcctg
ggctgcctgctgagccacgccgccgccgcgccgtcgcccatcatcaagttccccggcgat
gtcgcccccaaaacggacaaagagttggcagtgcaatacctgaacaccttctatggctgc
cccaaggagagctgcaacctgtttgtgctgaaggacacactaaagaagatgcagaagttc
tttggactgccccagacaggtgatcttgaccagaataccatcgagaccatgcggaagcca
cgctgcggcaacccagatgtggccaactacaacttcttccctcgcaagcccaagtgggac
aagaaccagatcacatacaggatcattggctacacacctgatctggacccagagacagtg
gatgatgcctttgctcgtgccttccaagtctggagcgatgtgaccccactgcggttttct
cgaatccatgatggagaggcagacatcatgatcaactttggccgctgggagcatggcgat
ggatacccctttgacggtaaggacggactcctggctcatgccttcgccccaggcactggt
gttgggggagactcccattttgatgacgatgagctatggaccttgggagaaggccaagtg
gtccgtgtgaagtatgggaacgccgatggggagtactgcaagttccccttcttgttcaat
ggcaaggagtacaacagctgcactgataccggccgcagcgatggcttcctctggtgctcc
accacctacaactttgagaaggatggcaagtacggcttctgtccccatgaagccctgttc
accatgggcggcaacgctgaaggacagccctgcaagtttccattccgcttccagggcaca
tcctatgacagctgcaccactgagggccgcacggatggctaccgctggtgcggcaccact
gaggactacgaccgcgacaagaagtatggcttctgccctgagaccgccatgtccactgtt
ggtgggaactcagaaggtgccccctgtgtcttccccttcactttcctgggcaacaaatat
gagagctgcaccagcgccggccgcagtgacggaaagatgtggtgtgcgaccacagccaac
tacgatgatgaccgcaagtggggcttctgccctgaccaagggtacagcctgttcctcgtg
gcagcccacgagtttggccacgccatggggctggagcactcccaagaccctggggccctg
atggcacccatttacacctacaccaagaacttccgtctgtcccaggatgacatcaagggc
attcaggagctctatggggcctctcctgacattgaccttggcaccggccccacccccacg
ctgggccctgtcactcctgagatctgcaaacaggacattgtatttgatggcatcgctcag
atccgtggtgagatcttcttcttcaaggaccggttcatttggcggactgtgacgccacgt
gacaagcccatggggcccctgctggtggccacattctggcctgagctcccggaaaagatt
gatgcggtatacgaggccccacaggaggagaaggctgtgttctttgcagggaatgaatac
tggatctactcagccagcaccctggagcgagggtaccccaagccactgaccagcctggga
ctgccccctgatgtccagcgagtggatgccgcctttaactggagcaaaaacaagaagaca
tacatctttgctggagacaaattctggagatacaatgaggtgaagaagaaaatggatcct
ggcttccccaagctcatcgcagatgcctggaatgccatccccgataacctggatgccgtc
gtggacctgcagggcggcggtcacagctacttcttcaagggtgcctattacctgaagctg
gagaaccaaagtctgaagagcgtgaagtttggaagcatcaaatccgactggctaggctgc
tga

DBGET integrated database retrieval system