KEGG   Homo sapiens (human): 4316Help
Entry
4316              CDS       T01001                                 

Gene name
MMP7, MMP-7, MPSL1, PUMP-1
Definition
(RefSeq) matrix metallopeptidase 7
  KO
K01397  matrix metalloproteinase-7 (matrilysin, uterine) [EC:3.4.24.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06123  TNF signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06223  TNF-NFKB signaling
  Element
N00503  HTLV-1 Tax to TNF-JNK signaling pathway
Drug target
Marimastat: D03795
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    4316 (MMP7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4316 (MMP7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    4316 (MMP7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.23  matrilysin
     4316 (MMP7)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M10
   4316 (MMP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 PG_binding_1 Metallopep Peptidase_M54 Peptidase_M66 Reprolysin_5 Peptidase_M57 Reprolysin_3
Motif
Other DBs
NCBI-GeneID: 4316
NCBI-ProteinID: NP_002414
OMIM: 178990
HGNC: 7174
Ensembl: ENSG00000137673
Vega: OTTHUMG00000048193
Pharos: P09237(Tclin)
UniProt: P09237
Structure
PDB: 

Position
11q22.2
AA seq 267 aa AA seqDB search
MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL
PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF
APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD
PQNFKLSQDDIKGIQKLYGKRSNSRKK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcgactcaccgtgctgtgtgctgtgtgcctgctgcctggcagcctggccctgccgctg
cctcaggaggcgggaggcatgagtgagctacagtgggaacaggctcaggactatctcaag
agattttatctctatgactcagaaacaaaaaatgccaacagtttagaagccaaactcaag
gagatgcaaaaattctttggcctacctataactggaatgttaaactcccgcgtcatagaa
ataatgcagaagcccagatgtggagtgccagatgttgcagaatactcactatttccaaat
agcccaaaatggacttccaaagtggtcacctacaggatcgtatcatatactcgagactta
ccgcatattacagtggatcgattagtgtcaaaggctttaaacatgtggggcaaagagatc
cccctgcatttcaggaaagttgtatggggaactgctgacatcatgattggctttgcgcga
ggagctcatggggactcctacccatttgatgggccaggaaacacgctggctcatgccttt
gcgcctgggacaggtctcggaggagatgctcacttcgatgaggatgaacgctggacggat
ggtagcagtctagggattaacttcctgtatgctgcaactcatgaacttggccattctttg
ggtatgggacattcctctgatcctaatgcagtgatgtatccaacctatggaaatggagat
ccccaaaattttaaactttcccaggatgatattaaaggcattcagaaactatatggaaag
agaagtaattcaagaaagaaatag

DBGET integrated database retrieval system