KEGG   Homo sapiens (human): 4682
Entry
4682              CDS       T01001                                 
Symbol
NUBP1, CIAO5, NBP, NBP1, NBP35
Name
(RefSeq) NUBP iron-sulfur cluster assembly factor 1, cytosolic
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: ParA CbiA AAA_31 ArsA_ATPase nSTAND3 MipZ Fer4_NifH RsgA_GTPase AAA_25 CLP1_P NB-ARC NACHT TsaE PcrB CBP_BcsQ DUF87 DAP3 AAA_16 Zeta_toxin SRP54 ABC_tran AAA_22 RNA_helicase AAA_14 VapE-like_dom
Other DBs
NCBI-GeneID: 4682
NCBI-ProteinID: NP_002475
OMIM: 600280
HGNC: 8041
Ensembl: ENSG00000103274
UniProt: P53384
Position
16:10743842..10769351
AA seq 320 aa
MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVL
SGKGGVGKSTFSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPV
YVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEH
LSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKK
ESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSII
QRIQEFCNLHQSKEENLISS
NT seq 963 nt   +upstreamnt  +downstreamnt
atggaggaggtgcctcacgactgtccaggggccgacagcgcccaggcgggcagaggggct
tcatgtcagggatgccccaaccagcggctgtgcgcttctggagcgggggccactccggac
acggctatagaggaaatcaaagagaaaatgaagactgtaaaacacaaaatcttggtattg
tctgggaaaggcggtgttgggaaaagcacattcagcgcccaccttgcccatggcctagca
gaggatgaaaacacacagattgctcttctagacatcgatatatgtgggccatcgattccc
aagataatgggattggaaggagagcaggttcaccagagtggctcaggctggtctccagtg
tacgtggaagacaacctgggggtgatgtcagtgggcttcctgctcagcagtcctgatgat
gctgttatctggaggggacccaagaaaaacggcatgatcaagcagttcctccgagatgtg
gactggggagaggtcgactacctcattgtggacaccccacctgggacgtcggatgaacac
ctctcggtcgtccggtacctggccacagcacacatcgatggagcagtgatcatcaccact
ccccaggaggtgtcactccaggatgtccggaaagaaatcaacttctgccgcaaggtgaag
ctgcccatcatcggggtggtggagaacatgagtggcttcatctgtcctaagtgcaagaaa
gaatctcagatattccctcccacaaccgggggcgcggagctcatgtgccaggacttggag
gtccctctcctcggcagagtgcccctggatccgctcataggtaagaattgtgacaaaggc
cagtcttttttcattgacgccccagattccccagccacgttagcctacagaagtataatt
cagagaatccaagagttttgtaatctccatcagtcaaaagaagagaacctcatcagttcc
tga

DBGET integrated database retrieval system