KEGG   Homo sapiens (human): 4735Help
Entry
4735              CDS       T01001                                 

Gene name
SEPTIN2, DIFF6, NEDD-5, NEDD5, Pnutl3, SEPT2, hNedd5
Definition
(RefSeq) septin 2
  KO
K16942  septin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    4735 (SEPTIN2)
   05100 Bacterial invasion of epithelial cells
    4735 (SEPTIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4735 (SEPTIN2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    4735 (SEPTIN2)
   04147 Exosome [BR:hsa04147]
    4735 (SEPTIN2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    4735 (SEPTIN2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     4735 (SEPTIN2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4735 (SEPTIN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 GTP_EFTU RsgA_GTPase AIG1 Ras Dynamin_N AAA_16 AAA_22 Roc Gtr1_RagA AAA_29 ABC_tran AAA_7 IIGP FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 4735
NCBI-ProteinID: NP_001008491
OMIM: 601506
HGNC: 7729
Ensembl: ENSG00000168385
Vega: OTTHUMG00000133394
Pharos: Q15019(Tbio)
UniProt: Q15019
Structure
PDB: 

Position
2q37.3
AA seq 361 aa AA seqDB search
MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLT
DLYPERVIPGAAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIIS
YIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPV
IAKADTLTLKERERLKKRILDEIEEHNIKIYHLPDAESDEDEDFKEQTRLLKASIPFSVV
GSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLITHMQDLQEVTQDLHYENFR
SERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQMQMQGGDGDGGALGHH
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagcaacagccaactcagtttataaatccagaaacacctggctatgttggattt
gcaaacctccccaatcaagttcaccgaaaatcagtgaaaaaaggttttgagttcacactg
atggtggtcggtgaatcaggtctaggaaaatcgactctcataaacagcctattcctaact
gatctgtacccagaaagagtcatacctggagcagcagaaaaaattgaaagaactgtccag
attgaggcttcaactgttgaaattgaagagcgaggggtcaagctacgcctgacagtggta
gatacccctggctatggtgacgctatcaactgcagagattgttttaagacaattatctcc
tatattgatgagcaatttgagaggtacctgcatgacgagagcggcttgaacaggcggcac
atcattgataatagggtgcattgttgcttttactttatttcaccttttggacatggactt
aagcccttagatgtggcgtttatgaaggcaatacacaacaaggtgaatattgtgcctgtc
attgcaaaagctgacactctcaccctgaaggaacgggagcggctgaagaaaaggattctg
gatgaaattgaagaacataacatcaaaatctatcacttacctgatgcagaatcagatgaa
gatgaagattttaaagagcagactagacttctcaaggctagcatcccattctctgtggtt
ggatccaatcagttgattgaagccaaaggaaagaaggtcagaggccgcctctacccctgg
ggtgttgtggaagtggagaacccagagcacaatgactttctgaagctgagaaccatgctc
atcacccacatgcaggatctccaggaggtgacccaggaccttcattatgaaaacttccgt
tctgagagactcaagagaggcggcaggaaagtggagaatgaggacatgaataaagaccag
atcttgctggaaaaagaagctgagctccgccgcatgcaagagatgattgcaaggatgcag
gcgcagatgcagatgcagatgcagggcggggatggcgatggcggggctctcgggcaccac
gtgtaa

DBGET integrated database retrieval system