KEGG   Homo sapiens (human): 4790Help
Entry
4790              CDS       T01001                                 

Gene name
NFKB1, CVID12, EBP-1, KBF1, NF-kB1, NF-kappa-B, NF-kappaB, NFKB-p105, NFKB-p50, NFkappaB, p105, p50
Definition
(RefSeq) nuclear factor kappa B subunit 1
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04211  Longevity regulating pathway
hsa04218  Cellular senescence
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04917  Prolactin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04926  Relaxin signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05030  Cocaine addiction
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
hsa05212  Pancreatic cancer
hsa05215  Prostate cancer
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05222  Small cell lung cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00686  Toll-like receptor signaling
Network
N00140  FUS-DDIT3 fusion to NFKB-mediated transcription
N00151  TNF-NFKB signaling pathway
N00171  KSHV vFLIP to NFKB signaling pathway
N00173  KSHV K15 to NFKB signaling pathway
N00174  KSHV vFLIP to TNF-NFKB signaling pathway
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00179  KSHV K1 to PI3K-NFKB signaling pathway
N00182  IGF-IGFR-PI3K-NFKB signaling pathway
N00221  HTLV-I Tax to host-cell-protein activation
N00267  HBV HBx to host-cell-protein activation
N00269  HCV Core to host-cell-protein activation
N00389  HCMV IE1-72 to transcription
N00390  EGF-EGFR-PI3K-NFKB signaling pathway
N00391  HCMV gB to EGFR-PI3K-NFKB signaling pathway
N00397  HCMV UL26 to TNF-NFKB signaling pathway
N00398  HCMV IE2-86 to TNF-NFKB signaling pathway
N00399  CCR2-GNB/G-PI3K-NFKB signaling pathway
N00400  HCMV US28 to GNB/G-PI3K-NFKB signaling pathway
Drug target
Iguratimod: D01146
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    4790 (NFKB1)
   04010 MAPK signaling pathway
    4790 (NFKB1)
   04064 NF-kappa B signaling pathway
    4790 (NFKB1)
   04668 TNF signaling pathway
    4790 (NFKB1)
   04066 HIF-1 signaling pathway
    4790 (NFKB1)
   04071 Sphingolipid signaling pathway
    4790 (NFKB1)
   04024 cAMP signaling pathway
    4790 (NFKB1)
   04151 PI3K-Akt signaling pathway
    4790 (NFKB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    4790 (NFKB1)
   04218 Cellular senescence
    4790 (NFKB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    4790 (NFKB1)
   04621 NOD-like receptor signaling pathway
    4790 (NFKB1)
   04622 RIG-I-like receptor signaling pathway
    4790 (NFKB1)
   04623 Cytosolic DNA-sensing pathway
    4790 (NFKB1)
   04625 C-type lectin receptor signaling pathway
    4790 (NFKB1)
   04660 T cell receptor signaling pathway
    4790 (NFKB1)
   04658 Th1 and Th2 cell differentiation
    4790 (NFKB1)
   04659 Th17 cell differentiation
    4790 (NFKB1)
   04657 IL-17 signaling pathway
    4790 (NFKB1)
   04662 B cell receptor signaling pathway
    4790 (NFKB1)
   04062 Chemokine signaling pathway
    4790 (NFKB1)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    4790 (NFKB1)
   04917 Prolactin signaling pathway
    4790 (NFKB1)
   04926 Relaxin signaling pathway
    4790 (NFKB1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4790 (NFKB1)
  09158 Development
   04380 Osteoclast differentiation
    4790 (NFKB1)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    4790 (NFKB1)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    4790 (NFKB1)
   05202 Transcriptional misregulation in cancers
    4790 (NFKB1)
   05206 MicroRNAs in cancer
    4790 (NFKB1)
   05203 Viral carcinogenesis
    4790 (NFKB1)
   05212 Pancreatic cancer
    4790 (NFKB1)
   05221 Acute myeloid leukemia
    4790 (NFKB1)
   05220 Chronic myeloid leukemia
    4790 (NFKB1)
   05215 Prostate cancer
    4790 (NFKB1)
   05222 Small cell lung cancer
    4790 (NFKB1)
  09162 Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    4790 (NFKB1)
  09164 Substance dependence
   05030 Cocaine addiction
    4790 (NFKB1)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    4790 (NFKB1)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4790 (NFKB1)
   04931 Insulin resistance
    4790 (NFKB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    4790 (NFKB1)
  09167 Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    4790 (NFKB1)
   05132 Salmonella infection
    4790 (NFKB1)
   05131 Shigellosis
    4790 (NFKB1)
   05133 Pertussis
    4790 (NFKB1)
   05134 Legionellosis
    4790 (NFKB1)
   05152 Tuberculosis
    4790 (NFKB1)
   05166 HTLV-I infection
    4790 (NFKB1)
   05162 Measles
    4790 (NFKB1)
   05164 Influenza A
    4790 (NFKB1)
   05161 Hepatitis B
    4790 (NFKB1)
   05160 Hepatitis C
    4790 (NFKB1)
   05168 Herpes simplex infection
    4790 (NFKB1)
   05163 Human cytomegalovirus infection
    4790 (NFKB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    4790 (NFKB1)
   05169 Epstein-Barr virus infection
    4790 (NFKB1)
   05165 Human papillomavirus infection
    4790 (NFKB1)
   05146 Amoebiasis
    4790 (NFKB1)
   05145 Toxoplasmosis
    4790 (NFKB1)
   05140 Leishmaniasis
    4790 (NFKB1)
   05142 Chagas disease (American trypanosomiasis)
    4790 (NFKB1)
  09168 Drug resistance
   01523 Antifolate resistance
    4790 (NFKB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4790 (NFKB1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    4790 (NFKB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_4 Ank Ank_3 Ank_5 Death
Motif
Other DBs
NCBI-GeneID: 4790
NCBI-ProteinID: NP_001158884
OMIM: 164011
HGNC: 7794
Ensembl: ENSG00000109320
Vega: OTTHUMG00000161080
Pharos: P19838(Tchem)
UniProt: P19838 A0A024RDJ4
Structure
PDB: 

Position
4q24
AA seq 968 aa AA seqDB search
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA
EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF
SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH
PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGE
VTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD
ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED
LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM
SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT
TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAT
SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG
LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ
AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQ
EGPLEGKI
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagatgatccatatttgggaaggcctgaacaaatgtttcatttggatccttct
ttgactcatacaatatttaatccagaagtatttcaaccacagatggcactgccaacagat
ggcccataccttcaaatattagagcaacctaaacagagaggatttcgtttccgttatgta
tgtgaaggcccatcccatggtggactacctggtgcctctagtgaaaagaacaagaagtct
taccctcaggtcaaaatctgcaactatgtgggaccagcaaaggttattgttcagttggtc
acaaatggaaaaaatatccacctgcatgcccacagcctggtgggaaaacactgtgaggat
gggatctgcactgtaactgctggacccaaggacatggtggtcggcttcgcaaacctgggt
atacttcatgtgacaaagaaaaaagtatttgaaacactggaagcacgaatgacagaggcg
tgtataaggggctataatcctggactcttggtgcaccctgaccttgcctatttgcaagca
gaaggtggaggggaccggcagctgggagatcgggaaaaagagctaatccgccaagcagct
ctgcagcagaccaaggagatggacctcagcgtggtgcggctcatgtttacagcttttctt
ccggatagcactggcagcttcacaaggcgcctggaacccgtggtatcagacgccatctat
gacagtaaagcccccaatgcatccaacttgaaaattgtaagaatggacaggacagctgga
tgtgtgactggaggggaggaaatttatcttctttgtgacaaagttcagaaagatgacatc
cagattcgattttatgaagaggaagaaaatggtggagtctgggaaggatttggagatttt
tcccccacagatgttcatagacaatttgccattgtcttcaaaactccaaagtataaagat
attaatattacaaaaccagcctctgtgtttgtccagcttcggaggaaatctgacttggaa
actagtgaaccaaaacctttcctctactatcctgaaatcaaagataaagaagaagtgcag
aggaaacgtcagaagctcatgcccaatttttcggatagtttcggcggtggtagtggtgct
ggagctggaggcggaggcatgtttggtagtggcggtggaggagggggcactggaagtaca
ggtccagggtatagcttcccacactatggatttcctacttatggtgggattactttccat
cctggaactactaaatctaatgctgggatgaagcatggaaccatggacactgaatctaaa
aaggaccctgaaggttgtgacaaaagtgatgacaaaaacactgtaaacctctttgggaaa
gttattgaaaccacagagcaagatcaggagcccagcgaggccaccgttgggaatggtgag
gtcactctaacgtatgcaacaggaacaaaagaagagagtgctggagttcaggataacctc
tttctagagaaggctatgcagcttgcaaagaggcatgccaatgcccttttcgactacgcg
gtgacaggagacgtgaagatgctgctggccgtccagcgccatctcactgctgtgcaggat
gagaatggggacagtgtcttacacttagcaatcatccaccttcattctcaacttgtgagg
gatctactagaagtcacatctggtttgatttctgatgacattatcaacatgagaaatgat
ctgtaccagacgcccttgcacttggcagtgatcactaagcaggaagatgtggtggaggat
ttgctgagggctggggccgacctgagccttctggaccgcttgggtaactctgttttgcac
ctagctgccaaagaaggacatgataaagttctcagtatcttactcaagcacaaaaaggca
gcactacttcttgaccaccccaacggggacggtctgaatgccattcatctagccatgatg
agcaatagcctgccatgtttgctgctgctggtggccgctggggctgacgtcaatgctcag
gagcagaagtccgggcgcacagcactgcacctggctgtggagcacgacaacatctcattg
gcaggctgcctgctcctggagggtgatgcccatgtggacagtactacctacgatggaacc
acacccctgcatatagcagctgggagagggtccaccaggctggcagctcttctcaaagca
gcaggagcagatcccctggtggagaactttgagcctctctatgacctggatgactcttgg
gaaaatgcaggagaggatgaaggagttgtgcctggaaccacgcctctagatatggccacc
agctggcaggtatttgacatattaaatgggaaaccatatgagccagagtttacatctgat
gatttactagcacaaggagacatgaaacagctggctgaagatgtgaagctgcagctgtat
aagttactagaaattcctgatccagacaaaaactgggctactctggcgcagaaattaggt
ctggggatacttaataatgccttccggctgagtcctgctccttccaaaacacttatggac
aactatgaggtctctgggggtacagtcagagagctggtggaggccctgagacaaatgggc
tacaccgaagcaattgaagtgatccaggcagcctccagcccagtgaagaccacctctcag
gcccactcgctgcctctctcgcctgcctccacaaggcagcaaatagacgagctccgagac
agtgacagtgtctgcgacagcggcgtggagacatccttccgcaaactcagctttaccgag
tctctgaccagtggtgcctcactgctaactctcaacaaaatgccccatgattatgggcag
gaaggacctctagaaggcaaaatttag

DBGET integrated database retrieval system