KEGG   Homo sapiens (human): 51479
Entry
51479             CDS       T01001                                 
Symbol
ANKFY1, ANKHZN, BTBD23, ZFYVE14
Name
(RefSeq) ankyrin repeat and FYVE domain containing 1
  KO
K20129  rabankyrin-5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51479 (ANKFY1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    51479 (ANKFY1)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_3 Ank Ank_5 BTB FYVE BACK Val_tRNA-synt_C
Other DBs
NCBI-GeneID: 51479
NCBI-ProteinID: NP_001316992
OMIM: 607927
HGNC: 20763
Ensembl: ENSG00000185722
Pharos: Q9P2R3(Tbio)
UniProt: Q9P2R3
Position
17:complement(4163821..4263979)
AA seq 1169 aa
MAEEEVAKLEKHLMLLRQEYVKLQKKLAETEKRCALLAAQANKESSSESFISRLLAIVAD
LYEQEQYSDLKIKVGDRHISAHKFVLAARSDSWSLANLSSTKELDLSDANPEVTMTMLRW
IYTDELEFREDDVFLTELMKLANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNAS
TLMNYCAEIIASHWDDLRKEDFSSMSAQLLYKMIKSKTEYPLHKAIKVEREDVVFLYLIE
MDSQLPGKLNEADHNGDLALDLALSRRLESIATTLVSHKADVDMVDKSGWSLLHKGIQRG
DLFAATFLIKNGAFVNAATLGAQETPLHLVALYSSKKHSADVMSEMAQIAEALLQAGANP
NMQDSKGRTPLHVSIMAGNEYVFSQLLQCKQLDLELKDHEGSTALWLAVQHITVSSDQSV
NPFEDVPVVNGTSFDENSFAARLIQRGSHTDAPDTATGNCLLQRAAGAGNEAAALFLATN
GAHVNHRNKWGETPLHTACRHGLANLTAELLQQGANPNLQTEEALPLPKEAASLTSLADS
VHLQTPLHMAIAYNHPDVVSVILEQKANALHATNNLQIIPDFSLKDSRDQTVLGLALWTG
MHTIAAQLLGSGAAINDTMSDGQTLLHMAIQRQDSKSALFLLEHQADINVRTQDGETALQ
LAIRNQLPLVVDAICTRGADMSVPDEKGNPPLWLALANNLEDIASTLVRHGCDATCWGPG
PGGCLQTLLHRAIDENNEPTACFLIRSGCDVNSPRQPGANGEGEEEARDGQTPLHLAASW
GLEETVQCLLEFGANVNAQDAEGRTPIHVAISSQHGVIIQLLVSHPDIHLNVRDRQGLTP
FACAMTFKNNKSAEAILKRESGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVHANVNSR
VQDASKLTPLHLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDLPTICSVLLE
NGVDFAAVDENGNNALHLAVMHGRLNNIRVLLTECTVDAEAFNLRGQSPLHILGQYGKEN
AAAIFDLFLECMPGYPLDKPDADGSTVLLLAYMKGNANLCRAIVRSGARLGVNNNQGVNI
FNYQVATKQLLFRLLDMLSKEPPWCDGSYCYECTARFGVTTRKHHCRHCGRLLCHKCSTK
EIPIIKFDLNKPVRVCNICFDVLTLGGVS
NT seq 3510 nt   +upstreamnt  +downstreamnt
atggcggaagaggaggtggccaagttggagaagcacttgatgcttctgcggcaggagtat
gtcaagctgcagaagaagctggcggagacagagaagcgctgcgctctcttggctgcgcag
gcaaacaaggagagcagcagcgagtccttcatcagccgtctgctggccatcgtggcagac
ctctacgagcaggagcagtacagcgatctgaagataaaggttggggacaggcacatcagt
gctcacaagtttgtcctggcagcccgcagtgacagctggagtctggctaacttgtcttcc
actaaagagttggacctgtcagatgctaatcctgaggtgacgatgacaatgcttcgctgg
atctatacagatgagctggagttcagagaggatgatgtgttcctgactgaactgatgaaa
ctagcaaatcggtttcagctacagctcctcagggagagatgtgagaagggtgttatgtct
ctagtgaatgtcaggaactgtattcgcttctaccagacggcagaggagctgaatgccagc
acactgatgaactactgtgcagaaattattgcaagtcattgggacgacctgaggaaggag
gatttcagcagcatgagcgctcagttgttatacaaaatgatcaaatccaagacagagtac
ccgctacataaagccatcaaagtggagagagaagacgtggtcttcctgtatctgattgaa
atggattcccagctccctgggaagctgaatgaagcggatcataacggagatctggcatta
gatctagccctctcacgacgactggagagtattgccaccacgctggttagtcacaaagct
gatgtggacatggtggacaagagtggctggagcttgttacacaaaggaatccaaagagga
gatctctttgctgccactttcctcattaagaatggggcctttgtcaacgctgctacactg
ggtgcccaggagacaccactgcaccttgtggccttgtacagttcaaagaaacactcagca
gatgtgatgtctgagatggcgcagattgcagaggcccttctgcaggctggtgccaacccc
aacatgcaggacagcaaggggaggactcctttacatgtgtccatcatggccgggaatgaa
tatgtgttcagtcagctgctgcagtgcaaacaactagatttagaactcaaagaccacgag
ggcagcacggctctgtggctggcagtgcagcatatcacagtgtcttctgaccagtctgtg
aaccccttcgaagatgtccccgtggtaaatgggacttcatttgatgagaacagctttgca
gccagactcatccagcgcggcagccacacagacgcacctgacacggcgacaggaaactgt
ttactacagcgggcagctggagcaggaaacgaggcagcagctcttttcctggcaaccaac
ggtgcccatgtcaaccacagaaacaagtggggagaaaccccgttgcacacagcgtgtcgg
catggcctggccaacctcacggcagagctcctgcagcaaggcgccaacccaaacctgcag
acggaggaagctctgcctctgccaaaggaggccgcatccctgaccagcttggcggacagc
gtccatctgcagacgccactgcacatggcgatcgcctataaccatccggatgtggtgtct
gtcatcctggagcagaaagccaatgctcttcatgccaccaacaacttgcagatcattccg
gacttcagcctcaaagattcccgagaccagactgtgctgggcctggcattatggactggc
atgcacacgatcgcagcccagctgctgggctctggagccgccatcaatgacaccatgtcg
gatgggcagacgctactgcacatggccatacagcggcaggacagcaagagcgcactcttc
ctgctggagcaccaggcagatataaatgtcaggactcaggacggggagacagccctccag
ctggccatcagaaaccagcttccactcgtagttgatgccatatgcacccgaggagctgac
atgtctgtgccagatgagaaggggaaccccccgctgtggcttgcattggcaaacaatctg
gaggacatcgcatccactctggtcagacatggctgtgatgccacatgctggggtccggga
cctggtgggtgccttcagacgctcctgcacagagccattgatgaaaacaacgagcccacc
gcctgctttcttattcgcagtggctgtgacgtgaacagtcccagacaaccaggcgccaat
ggagaaggagaggaagaggctagagatgggcagacccctttgcatttggcagcctcttgg
gggctggaagagacagtacagtgtcttctggagtttggtgccaacgtgaacgcacaggat
gcagaaggaagaacccccatccacgtggccatcagcagccaacacggtgtcatcattcag
ctgttggtttctcaccccgatatccatttgaatgtacgagacagacaagggctgaccccg
tttgcctgtgccatgactttcaagaacaacaagtcagccgaggccattctcaaacgagag
tccggggctgctgagcaggtggataacaagggccggaatttccttcatgtggcagttcag
aactctgatattgaaagtgtgctgttcctgatcagtgtccacgctaatgtgaattcaaga
gtccaggatgcctccaagttgacccccctgcacctcgctgtccaagcaggctcagaaatt
attgtccgcaatttgcttcttgcgggagccaaagtgaacgaattaaccaagcatcgccag
actgccctccatcttgctgcccagcaggacctgcccaccatctgctcagtcctcctagag
aatggcgtggactttgctgccgtggatgagaatggaaacaatgctcttcatcttgctgtc
atgcacggccggctcaacaacatccgggttctcctgacagagtgcacagtggacgccgaa
gcctttaatctcagaggccagtcaccactgcacattttgggacaatatggcaaggagaat
gcagcggccatctttgatctcttcctagaatgcatgccggggtatcctctggacaagccg
gatgcagacggcagcacggtgctgctcctggcatacatgaaagggaacgccaacttgtgc
cgcgccatcgtccggtcgggggctcgcctcggggtgaataacaaccagggagtcaacatc
ttcaactaccaggtcgccaccaagcagctcctgttccgactgctggatatgctgtccaag
gagcctccgtggtgtgacggctcctactgctatgagtgcactgccaggttcggagtcacc
actcgcaaacaccactgtcgtcactgcggacgtcttctttgccataaatgctcgaccaag
gagattcctattataaagtttgatctgaacaagcctgtgcgggtttgcaacatttgtttt
gatgtactgactctgggtggggtttcttag

DBGET integrated database retrieval system