KEGG   Homo sapiens (human): 5243Help
Entry
5243              CDS       T01001                                 

Gene name
ABCB1, ABC20, CD243, CLCS, GP170, MDR1, P-GP, PGY1
Definition
(RefSeq) ATP binding cassette subfamily B member 1
  KO
K05658  ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:7.6.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa02010  ABC transporters
hsa04976  Bile secretion
hsa05206  MicroRNAs in cancer
hsa05226  Gastric cancer
Network
N00250  CDX2-overexpression to transcriptional activation
Disease
H01227  Inflammatory bowel disease (IBD)
H01529  Avascular necrosis of femoral head
H01709  Glucocorticoid-induced osteonecrosis
Drug target
Biricodar dicitrate: D03128
Elacridar hydrochloride: D03968
Tariquidar: D06008
Tesmilifene hydrochloride: D06084
Valspodar: D06277
Zosuquidar trihydrochloride: D06387
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    5243 (ABCB1)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    5243 (ABCB1)
 09160 Human Diseases
  09161 Cancers: Overview
   05206 MicroRNAs in cancer
    5243 (ABCB1)
  09162 Cancers: Specific types
   05226 Gastric cancer
    5243 (ABCB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    5243 (ABCB1)
   04147 Exosome [BR:hsa04147]
    5243 (ABCB1)
   04090 CD molecules [BR:hsa04090]
    5243 (ABCB1)
Enzymes [BR:hsa01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.2  ABC-type xenobiotic transporter
     5243 (ABCB1)
Transporters [BR:hsa02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    5243 (ABCB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5243 (ABCB1)
CD molecules [BR:hsa04090]
 Proteins
  5243 (ABCB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N ABC_ATPase AAA_16 AAA_22 RsgA_GTPase Rad17 Zeta_toxin G-alpha AAA AAA_29 AAA_5 AAA_7 AAA_15 AAA_14 APS_kinase SbcCD_C AAA_30 PRK DUF815 AAA_24 DUF2207
Motif
Other DBs
NCBI-GeneID: 5243
NCBI-ProteinID: NP_000918
OMIM: 171050
HGNC: 40
Ensembl: ENSG00000085563
Vega: OTTHUMG00000023393
Pharos: P08183(Tchem)
UniProt: P08183 A4D1D2
Structure
PDB: 

Position
7q21.12
AA seq 1280 aa AA seqDB search
MDLEGDRNGGAKKKNFFKLNNKSEKDKKEKKPTVSVFSMFRYSNWLDKLYMVVGTLAAII
HGAGLPLMMLVFGEMTDIFANAGNLEDLMSNITNRSDINDTGFFMNLEEDMTRYAYYYSG
IGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDDVS
KINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFT
DKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISIG
AAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSVLIGAFSVGQASPSIEAFANARG
AAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSG
QTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLF
ATTIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIA
IARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAG
FDDGVIVEKGNHDELMKEKGIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRS
SLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPYFVVGVFCAII
NGGLQPAFAIIFSKIIGVFTRIDDPETKRQNSNLFSLLFLALGIISFITFFLQGFTFGKA
GEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNI
ANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEA
IENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFG
AYLVAHKLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDS
YSTEGLMPNTLEGNVTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVV
QLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVV
SQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARALVRQPHILLLD
EATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQL
LAQKGIYFSMVSVQAGTKRQ
NT seq 3843 nt NT seq  +upstreamnt  +downstreamnt
atggatcttgaaggggaccgcaatggaggagcaaagaagaagaacttttttaaactgaac
aataaaagtgaaaaagataagaaggaaaagaaaccaactgtcagtgtattttcaatgttt
cgctattcaaattggcttgacaagttgtatatggtggtgggaactttggctgccatcatc
catggggctggacttcctctcatgatgctggtgtttggagaaatgacagatatctttgca
aatgcaggaaatttagaagatctgatgtcaaacatcactaatagaagtgatatcaatgat
acagggttcttcatgaatctggaggaagacatgaccaggtatgcctattattacagtgga
attggtgctggggtgctggttgctgcttacattcaggtttcattttggtgcctggcagct
ggaagacaaatacacaaaattagaaaacagttttttcatgctataatgcgacaggagata
ggctggtttgatgtgcacgatgttggggagcttaacacccgacttacagatgatgtctcc
aagattaatgaaggaattggtgacaaaattggaatgttctttcagtcaatggcaacattt
ttcactgggtttatagtaggatttacacgtggttggaagctaacccttgtgattttggcc
atcagtcctgttcttggactgtcagctgctgtctgggcaaagatactatcttcatttact
gataaagaactcttagcgtatgcaaaagctggagcagtagctgaagaggtcttggcagca
attagaactgtgattgcatttggaggacaaaagaaagaacttgaaaggtacaacaaaaat
ttagaagaagctaaaagaattgggataaagaaagctattacagccaatatttctataggt
gctgctttcctgctgatctatgcatcttatgctctggccttctggtatgggaccaccttg
gtcctctcaggggaatattctattggacaagtactcactgtattcttttctgtattaatt
ggggcttttagtgttggacaggcatctccaagcattgaagcatttgcaaatgcaagagga
gcagcttatgaaatcttcaagataattgataataagccaagtattgacagctattcgaag
agtgggcacaaaccagataatattaagggaaatttggaattcagaaatgttcacttcagt
tacccatctcgaaaagaagttaagatcttgaagggtctgaacctgaaggtgcagagtggg
cagacggtggccctggttggaaacagtggctgtgggaagagcacaacagtccagctgatg
cagaggctctatgaccccacagaggggatggtcagtgttgatggacaggatattaggacc
ataaatgtaaggtttctacgggaaatcattggtgtggtgagtcaggaacctgtattgttt
gccaccacgatagctgaaaacattcgctatggccgtgaaaatgtcaccatggatgagatt
gagaaagctgtcaaggaagccaatgcctatgactttatcatgaaactgcctcataaattt
gacaccctggttggagagagaggggcccagttgagtggtgggcagaagcagaggatcgcc
attgcacgtgccctggttcgcaaccccaagatcctcctgctggatgaggccacgtcagcc
ttggacacagaaagcgaagcagtggttcaggtggctctggataaggccagaaaaggtcgg
accaccattgtgatagctcatcgtttgtctacagttcgtaatgctgacgtcatcgctggt
ttcgatgatggagtcattgtggagaaaggaaatcatgatgaactcatgaaagagaaaggc
atttacttcaaacttgtcacaatgcagacagcaggaaatgaagttgaattagaaaatgca
gctgatgaatccaaaagtgaaattgatgccttggaaatgtcttcaaatgattcaagatcc
agtctaataagaaaaagatcaactcgtaggagtgtccgtggatcacaagcccaagacaga
aagcttagtaccaaagaggctctggatgaaagtatacctccagtttccttttggaggatt
atgaagctaaatttaactgaatggccttattttgttgttggtgtattttgtgccattata
aatggaggcctgcaaccagcatttgcaataatattttcaaagattataggggtttttaca
agaattgatgatcctgaaacaaaacgacagaatagtaacttgttttcactattgtttcta
gcccttggaattatttcttttattacatttttccttcagggtttcacatttggcaaagct
ggagagatcctcaccaagcggctccgatacatggttttccgatccatgctcagacaggat
gtgagttggtttgatgaccctaaaaacaccactggagcattgactaccaggctcgccaat
gatgctgctcaagttaaaggggctataggttccaggcttgctgtaattacccagaatata
gcaaatcttgggacaggaataattatatccttcatctatggttggcaactaacactgtta
ctcttagcaattgtacccatcattgcaatagcaggagttgttgaaatgaaaatgttgtct
ggacaagcactgaaagataagaaagaactagaaggttctgggaagatcgctactgaagca
atagaaaacttccgaaccgttgtttctttgactcaggagcagaagtttgaacatatgtat
gctcagagtttgcaggtaccatacagaaactctttgaggaaagcacacatctttggaatt
acattttccttcacccaggcaatgatgtatttttcctatgctggatgtttccggtttgga
gcctacttggtggcacataaactcatgagctttgaggatgttctgttagtattttcagct
gttgtctttggtgccatggccgtggggcaagtcagttcatttgctcctgactatgccaaa
gccaaaatatcagcagcccacatcatcatgatcattgaaaaaacccctttgattgacagc
tacagcacggaaggcctaatgccgaacacattggaaggaaatgtcacatttggtgaagtt
gtattcaactatcccacccgaccggacatcccagtgcttcagggactgagcctggaggtg
aagaagggccagacgctggctctggtgggcagcagtggctgtgggaagagcacagtggtc
cagctcctggagcggttctacgaccccttggcagggaaagtgctgcttgatggcaaagaa
ataaagcgactgaatgttcagtggctccgagcacacctgggcatcgtgtcccaggagccc
atcctgtttgactgcagcattgctgagaacattgcctatggagacaacagccgggtggtg
tcacaggaagagattgtgagggcagcaaaggaggccaacatacatgccttcatcgagtca
ctgcctaataaatatagcactaaagtaggagacaaaggaactcagctctctggtggccag
aaacaacgcattgccatagctcgtgcccttgttagacagcctcatattttgcttttggat
gaagccacgtcagctctggatacagaaagtgaaaaggttgtccaagaagccctggacaaa
gccagagaaggccgcacctgcattgtgattgctcaccgcctgtccaccatccagaatgca
gacttaatagtggtgtttcagaatggcagagtcaaggagcatggcacgcatcagcagctg
ctggcacagaaaggcatctatttttcaatggtcagtgtccaggctggaacaaagcgccag
tga

DBGET integrated database retrieval system