KEGG   Homo sapiens (human): 54882Help
Entry
54882             CDS       T01001                                 

Gene name
ANKHD1, MASK, MASK1, PP2500, VBARP
Definition
(RefSeq) ankyrin repeat and KH domain containing 1
  KO
K16726  ankyrin repeat domain-containing protein 17
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    54882 (ANKHD1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     54882 (ANKHD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank Ank_3 Ank_5 KH_1
Motif
Other DBs
NCBI-GeneID: 54882
NCBI-ProteinID: NP_060217
OMIM: 610500
HGNC: 24714
Ensembl: ENSG00000131503
Vega: OTTHUMG00000161610
Pharos: Q8IWZ3(Tbio)
UniProt: Q8IWZ3
Position
5q31.3
AA seq 2542 aa AA seqDB search
MLTDSGGGGTSFEEDLDSVAPRSAPAGASEPPPPGGVGLGIRTVRLFGEAGPASGVGSSG
GGGSGSGTGGGDAALDFKLAAAVLRTGGGGGASGSDEDEVSEVESFILDQEDLDNPVLKT
TSEIFLSSTAEGADLRTVDPETQARLEALLEAAGIGKLSTADGKAFADPEVLRRLTSSVS
CALDEAAAALTRMKAENSHNAGQVDTRSLAEACSDGDVNAVRKLLDEGRSVNEHTEEGES
LLCLACSAGYYELAQVLLAMHANVEDRGNKGDITPLMAASSGGYLDIVKLLLLHDADVNS
QSATGNTALTYACAGGFVDIVKVLLNEGANIEDHNENGHTPLMEAASAGHVEVARVLLDH
GAGINTHSNEFKESALTLACYKGHLDMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEV
ARLLLDSGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAR
EGHEEMVALLLAQGANINAQTEETQETALTLACCGGFSEVADFLIKAGADIELGCSTPLM
EASQEGHLELVKYLLASGANVHATTATGDTALTYACENGHTDVADVLLQAGADLEHESEG
GRTPLMKAARAGHLCTVQFLISKGANVNRATANNDHTVVSLACAGGHLAVVELLLAHGAD
PTHRLKDGSTMLIEAAKGGHTNVVSYLLDYPNNVLSVPTTDVSQLPPPSQDQSQVPRVPT
HTLAMVVPPQEPDRTSQENSPALLGVQKGTSKQKSSSLQVADQDLLPSFHPYQPLECIVE
ETEGKLNELGQRISAIEKAQLKSLELIQGEPLNKDKIEELKKNREEQVQKKKKILKELQK
VERQLQMKTQQQFTKEYLETKGQKDTVSLHQQCSHRGVFPEGEGDGSLPEDHFSELPQVD
TILFKDNDVDDEQQSPPSAEQIDFVPVQPLSSPQCNFSSDLGSNGTNSLELQKVSGNQQI
VGQPQIAITGHDQGLLVQEPDGLMVATPAQTLTDTLDDLIAAVSTRVPTGSNSSSQTTEC
LTPESCSQTTSNVASQSMPPVYPSVDIDAHTESNHDTALTLACAGGHEELVSVLIARDAK
IEHRDKKGFTPLILAATAGHVGVVEILLDKGGDIEAQSERTKDTPLSLACSGGRQEVVDL
LLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMN
GHVPAVKLLLDMGSDINAQIETNRNTALTLACFQGRAEVVSLLLDRKANVEHRAKTGLTP
LMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHYKFCELLIHRGAHIDV
RNKKGNTPLWLASNGGHFDVVQLLVQAGADVDAADNRKITPLMSAFRKGHVKVVQYLVKE
VNQFPSDIECMRYIATITDKELLKKCHQCVETIVKAKDQQAAEANKNASILLKELDLEKS
REESRKQALAAKREKRKEKRKKKKEEQKRKQEEDEENKPKENSELPEDEDEEENDEDVEQ
EVPIEPPSATTTTTIGISATSATFTNVFGKKRANVVTTPSTNRKNKKNKTKETPPTAHLI
LPEQHMSLAQQKADKNKINGEPRGGGAGGNSDSDNLDSTDCNSESSSGGKSQELNFVMDV
NSSKYPSLLLHSQEEKTSTATSKTQTRLEGEVTPNSLSTSYKTVSLPLSSPNIKLNLTSP
KRGQKREEGWKEVVRRSKKLSVPASVVSRIMGRGGCNITAIQDVTGAHIDVDKQKDKNGE
RMITIRGGTESTRYAVQLINALIQDPAKELEDLIPKNHIRTPASTKSIHANFSSGVGTTA
ASSKNAFPLGAPTLVTSQATTLSTFQPANKLNKNVPTNVRSSFPVSLPLAYPHPHFALLA
AQTMQQIRHPRLPMAQFGGTFSPSPNTWGPFPVRPVNPGNTNSSPKHNNTSRLPNQNGTV
LPSESAGLATASCPITVSSVVAASQQLCVTNTRTPSSVRKQLFACVPKTSPPATVISSVT
STCSSLPSVSSAPITSGQAPTTFLPASTSQAQLSSQKMESFSAVPPTKEKVSTQDQPMAN
LCTPSSTANSCSSSASNTPGAPETHPSSSPTPTSSNTQEEAQPSSVSDLSPMSMPFASNS
EPAPLTLTSPRMVAADNQDTSNLPQLAVPAPRVSHRMQPRGSFYSMVPNATIHQDPQSIF
VTNPVTLTPPQGPPAAVQLSSAVNIMNGSQMHINPANKSLPPTFGPATLFNHFSSLFDSS
QVPANQGWGDGPLSSRVATDASFTVQSAFLGNSVLGHLENMHPDNSKAPGFRPPSQRVST
SPVGLPSIDPSGSSPSSSSAPLASFSGIPGTRVFLQGPAPVGTPSFNRQHFSPHPWTSAS
NSSTSAPPTLGQPKGVSASQDRKIPPPIGTERLARIRQGGSVAQAPAGTSFVAPVGHSGI
WSFGVNAVSEGLSGWSQSVMGNHPMHQQLSDPSTFSQHQPMERDDSGMVAPSNIFHQPMA
SGFVDFSKGLPISMYGGTIIPSHPQLADVPGGPLFNGLHNPDPAWNPMIKVIQNSTECTD
AQQIWPGTWAPHIGNMHLKYVN
NT seq 7629 nt NT seq  +upstreamnt  +downstreamnt
atgctgactgatagcggaggcggcggcacctcctttgaggaggacctggactctgtggct
ccgcgatccgccccagctggggcctcggagccgcctccgccgggaggggtcggtctgggg
atccgcaccgtgaggctctttggggaggccgggccagcgtcgggagtcggcagcagcggc
ggcggcggcagcggcagcggtacgggcggaggggacgcggcgctggatttcaagttggcg
gctgccgtgctgaggaccgggggtggaggtggtgcctctggcagtgacgaggacgaagtg
tccgaggttgaatcatttattttggaccaagaagatctggataacccagtgcttaaaaca
acatcagagatattcttatcaagtactgcagaaggagcagacttacgcactgtggatcca
gagacacaggcacgactagaagcattgctagaagcagcaggaattggcaaattgtcaact
gctgatggtaaagcttttgcagatcctgaggtactccggagactgacatcctcagttagt
tgtgcactggatgaagctgctgctgcactgacacggatgaaagcagaaaacagccacaat
gcaggacaagtggacactcgcagtctagcagaagcttgttcagatggggatgttaatgct
gttcgtaaattgctagatgaaggcagaagtgtaaatgaacatacagaagaaggagaaagc
ctgctgtgtttggcttgttcagcagggtattatgaattagcacaagtattgcttgctatg
catgctaatgttgaagatcgagggaataaaggagacataactcccctgatggcagcttcc
agtggaggttacttagatattgtgaaattattacttcttcatgatgctgatgtcaactcc
cagtctgcaacaggaaacactgcgctaacttatgcatgtgctggaggatttgttgacatt
gttaaagtgctccttaatgaaggtgcaaatatagaagatcataatgaaaatggacatact
cccttaatggaagcagccagtgcaggtcatgtggaagttgcaagagttcttttagatcat
ggtgcaggcatcaacactcattctaatgaattcaaagaaagtgctctaacacttgcttgc
tacaaaggccatttggatatggttcgctttctacttgaagctggtgcagatcaagagcac
aaaacagatgagatgcacactgccttaatggaggcctgcatggatggacatgtagaggtg
gcacgtttgcttttggatagtggtgctcaagtgaacatgcctgcagattcatttgaatct
ccattgacgctagctgcctgtggaggacatgttgaattggcagctctacttattgaaagg
ggagcaaatcttgaagaagttaatgatgaaggatacactcccttgatggaagctgcccgg
gaaggacatgaagaaatggtggcactactcttagcacaaggagcaaatataaatgcccag
acagaagaaactcaagaaactgctcttactttggcttgctgtggaggattttctgaagtt
gcagactttcttattaaggcaggggctgatatagaacttggctgctccacacctctgatg
gaggcatctcaggagggacacctggaattggttaaatatttgctggcttctggcgctaat
gtgcatgctacaacagcaacaggagacacagccttaacctatgcttgtgaaaatggacat
acggatgttgcagatgttttacttcaagcaggggctgatttagaacatgaatctgaaggt
ggaagaacacctttgatgaaagctgcaagagctggtcatttgtgcactgtgcagtttctt
attagcaaaggtgccaatgttaacagggctacagccaataatgatcatacagtagtgtcg
ctggcatgtgcaggaggccacctggcagttgttgagcttctcttggctcatggggctgac
cctactcatcgactcaaggatggttcaacaatgctcattgaagctgcaaagggtggccat
actaatgtagtttcttatctgttggattatccaaataatgttctgtcagttcccaccaca
gatgtgtctcagctccctccaccttctcaagatcagtctcaggtgccacgtgtgccaacg
catacacttgccatggttgtacctccccaggaacctgacagaacttcacaggagaactct
cctgcccttttaggagtgcaaaaaggtacatccaagcagaagtccagttccctccaggta
gcagatcaggacctactgccatcttttcacccataccagcctttggagtgcatagtagag
gagactgaaggcaagctgaatgaactgggacaaagaattagtgctattgaaaaagcacag
cttaagtcactggagttaattcaaggtgaacctctgaacaaagataagatagaagaactt
aaaaagaacagagaagagcaagtccagaagaagaagaaaatattgaaagaactgcagaaa
gtggaaaggcagttgcagatgaaaacacagcagcaatttaccaaagaatacttggaaacc
aaaggtcagaaagacacagtgtctctacaccaacagtgctctcatagaggagtcttccca
gaaggggaaggagatggtagtctcccagaggatcacttttcagagttacctcaggttgac
acaatcttatttaaagataatgatgttgatgatgagcaacagtctccaccatcggcagaa
cagattgattttgtcccagtccagcctttatcatctccacagtgtaacttttccagtgac
ttaggttctaatgggacaaattctcttgaacttcagaaagtatcaggtaatcagcagatt
gtaggacagcctcagattgctattactggacatgatcaggggctgttagttcaagaacca
gatggactaatggttgcaactccagctcagacgcttaccgacactcttgatgacctgata
gcagctgtgagtaccagagtgcccactggttccaacagttcttctcagaccacagagtgt
cttacacctgaatcctgttcgcagactacaagcaatgtggcttcccaatcgatgcctcct
gtgtatccttcagttgacattgatgcacatactgagagcaatcatgacacagcattaaca
ctagcttgtgcaggtggtcatgaagaacttgtatctgtgctcattgcacgggatgccaaa
attgaacacagagacaaaaaaggtttcacaccactaatcctggcagcaacagcagggcat
gttggagttgttgaaatccttttggataaaggtggagatatagaagcacagtctgaacga
actaaggatactccgctttcattggcatgttctggtggacgtcaggaggtggtagacttg
ctgctggctcgaggtgcaaataaagaacataggaacgtatctgattatacaccactgagt
ctagctgcgtctggaggatatgttaatatcattaagattctgcttaatgctggggcagaa
attaattcaaggactgggagtaaactaggtatttctcccctgatgttggctgcaatgaat
ggacatgttcctgcagtaaaattgctgctcgatatgggttcagacattaatgcccaaata
gagaccaatcggaacacggctctcaccctggcctgtttccagggccgagcagaagtagtg
agtttgcttctggaccgaaaagccaatgttgaacatagggcaaagacgggtcttaccccc
ttgatggaagcagcttctggagggtatgcagaggttggaagagttcttcttgataaagga
gcagatgttaatgctccccctgtgccttcctcaagagatactgctttaacaatagcagca
gacaaaggtcactacaaattttgtgaactcctgattcataggggagcccacattgatgtt
cgtaacaaaaagggaaatacgccactttggctggcatccaatggaggtcattttgatgtt
gtgcagttgctagtgcaagcaggtgctgatgtggatgcagcagataaccggaaaatcaca
cctcttatgtcagcatttcgcaagggtcatgtaaaagttgttcaatatttggtaaaggaa
gtaaatcagttcccttctgatatagaatgcatgagatacatagcaacaattacagataag
gaactgttgaaaaaatgtcatcaatgtgtcgaaaccattgtgaaggctaaagaccagcaa
gctgcagaagcaaataagaatgcgagtattcttttaaaggaacttgatctggaaaagtca
agagaagagagcagaaagcaggctcttgctgctaaaagagaaaaaagaaaagaaaagaga
aaaaagaaaaaagaggaacagaaaaggaaacaggaagaagatgaagaaaacaaacctaag
gagaattcggaactaccagaggatgaagatgaagaggagaatgatgaagatgtggagcaa
gaagttcccatagaacctcctagtgcaaccaccaccactacgattggaatctctgcaaca
tctgcaacattcacaaatgtgtttgggaaaaaaagggccaatgtggtgacaactcccagc
accaatcggaaaaataagaagaacaaaacaaaagaaacccctcctacagcacatttaatt
ttaccagaacaacatatgtctttagcccaacaaaaggcagataaaaataaaataaatgga
gaacctagaggtggtggtgcaggtgggaatagtgattcagataacttggacagcacagac
tgcaacagtgagagtagcagtggtggtaaaagccaagagttaaattttgtgatggatgtg
aattcctctaaatacccctcactgctccttcattcccaagaagaaaagacaagtactgct
acttccaaaactcagacacgacttgaaggtgaagtgactcctaattccttgtcaaccagc
tacaagacagtgtcattgccattaagctctccaaacataaagctgaatctcactagccct
aaaaggggtcagaaaagagaagaagggtggaaagaagttgtacgaaggtcaaagaaattg
tctgttccagcctcagtggtgtcgaggataatgggaagaggaggatgcaacatcactgca
atacaggatgttactggtgcccatattgatgtggataaacaaaaagataagaatggcgag
agaatgatcacaataaggggtggcacagaatcaacaagatatgcagttcaactaatcaat
gcactcattcaagatcctgctaaggaactggaagacttgattcctaaaaatcatatcaga
acacctgccagcaccaaatcaattcatgctaacttctcatctggagtaggtaccacagca
gcttccagtaaaaatgcatttcctttgggtgctccaactcttgtaacttcacaggcaaca
acgttatctacgttccagcccgctaataaacttaataagaatgttccaacaaatgtacgt
tcttctttcccagtttctctacccttagcttatcctcaccctcattttgccctgctggct
gctcaaactatgcaacagattcggcatcctcgcttacccatggcccagtttggaggaacc
ttctcaccttctcctaacacatggggaccattcccagtgagacctgtgaatcctggcaac
acaaatagctctccaaagcataataacacaagccgtctacctaaccagaacgggactgtt
ttaccctcagagtctgctggactagctactgccagttgtcctatcactgtctcttctgta
gttgctgccagtcagcaactgtgtgtcactaatacccggactccttcatcagtcagaaag
cagttgtttgcctgtgtgcctaagacaagtcctccagcaacagtgatttcttctgtgaca
agcacttgtagttccctgccttctgtctcctctgcacctatcactagcgggcaagctccc
accacatttctacctgcaagtacttctcaagcacagctttcttcacaaaagatggagtct
ttctctgctgtgccacccaccaaagagaaagtgtccacacaggaccagcccatggcaaac
ctatgtaccccatcttcaactgcaaacagttgcagtagctctgccagcaacaccccggga
gctccagaaactcacccatccagtagtcccactcctacttccagtaacacacaagaggag
gcacagccatccagtgtgtctgatttaagtcctatgtcaatgccttttgcatctaactca
gaacctgctccattgactttgacatcacccagaatggttgctgctgataatcaggacacc
agtaatttacctcagttagctgtaccagcacctcgagtttctcatcgaatgcagcccaga
ggttctttttactccatggtaccaaatgcaactattcaccaggatccccagtctattttt
gttacgaatccagttactttaacaccacctcaaggcccaccagctgcagtgcagctttct
tcagctgtgaacattatgaatggttctcagatgcacataaacccagcaaataagtctttg
ccacctacatttggcccagccacacttttcaatcacttcagcagtctttttgatagtagt
caggtgccagctaaccagggctggggagatggtccactgtcctcacgagttgctacagat
gcctctttcactgttcagtcagcgttcctgggtaactcagtgcttggacacttggaaaac
atgcaccctgataactcaaaggcacctggcttcagaccaccttcccagcgagtttctact
agtccagttgggttaccatccattgacccatcaggcagctccccatcttcctcttctgct
cctctggcaagtttttccggcataccaggaacaagggttttcctgcaagggccagctcct
gttgggactcctagtttcaacagacaacatttttctccccatccttggacaagcgcctca
aactcatccacttctgccccaccaacgttgggccaaccaaaaggagtcagtgccagtcaa
gatcgaaagatacctcccccaattggaacagagagactggcccgaattcggcaaggaggg
tctgttgcacaagccccggcggggaccagttttgtcgctcccgttggacacagtggaatc
tggtcatttggtgtcaatgctgtgtcagaaggcttatcaggttggtcgcaatctgtgatg
gggaaccatccaatgcatcaacaattatcagacccaagcacattctcccaacatcagcca
atggagagagatgattctggaatggtagccccctctaacatttttcatcagcctatggca
agtggttttgtggatttttctaaaggtctgccaatttccatgtatggaggcaccataata
ccctctcatcctcagcttgctgatgttccaggaggccctctgtttaatggacttcacaat
ccagatcctgcttggaaccctatgataaaagttatccaaaattcaactgaatgcactgat
gcccagcagatttggcctggcacgtgggcacctcatattggaaacatgcatctcaaatat
gtcaactaa

DBGET integrated database retrieval system