KEGG   Homo sapiens (human): 5873
Entry
5873              CDS       T01001                                 
Symbol
RAB27A, GS2, HsT18676, RAB27, RAM
Name
(RefSeq) RAB27A, member RAS oncogene family
  KO
K07885  Ras-related protein Rab-27A
Organism
hsa  Homo sapiens (human)
Disease
H00101  Other phagocyte defects
H02022  Griscelli syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5873 (RAB27A)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    5873 (RAB27A)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    5873 (RAB27A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    5873 (RAB27A)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 TPP_enzyme_M
Other DBs
NCBI-GeneID: 5873
NCBI-ProteinID: NP_004571
OMIM: 603868
HGNC: 9766
Ensembl: ENSG00000069974
Pharos: P51159(Tbio)
UniProt: P51159 A2RU94
Structure
Position
15:complement(55202966..55289813)
AA seq 221 aa
MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDG
ATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMH
AYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDL
IMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC
NT seq 666 nt   +upstreamnt  +downstreamnt
atgtctgatggagattatgattacctcatcaagtttttagctttgggagactctggtgta
gggaagaccagtgtactttaccaatatacagatggtaaatttaactccaaatttatcaca
acagtgggcattgatttcagggaaaaaagagtggtgtacagagccagtgggccggatgga
gccactggcagaggccagagaatccacctgcagttatgggacacagcagggcaggagagg
tttcgtagcttaacgacagcgttcttcagagatgctatgggttttcttctactttttgat
ctgacaaatgagcaaagtttcctcaatgtcagaaactggataagccagctacagatgcat
gcatattgtgaaaacccagatatagtgctgtgtggaaacaagagtgatctggaggaccag
agagtagtgaaagaggaggaagccatagcactcgcagagaaatatggaatcccctacttt
gaaactagtgctgccaatgggacaaacataagccaagcaattgagatgcttctggacctg
ataatgaagcgaatggaacggtgtgtggacaagtcctggattcctgaaggagtggtgcga
tcaaatggtcatgcctctacggatcagttaagtgaagaaaaggagaaaggggcatgtggc
tgttga

DBGET integrated database retrieval system