KEGG   Homo sapiens (human): 5908Help
Entry
5908              CDS       T01001                                 

Gene name
RAP1B, K-REV, RAL1B
Definition
(RefSeq) RAP1B, member of RAS oncogene family
  KO
K07836  Ras-related protein Rap-1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04510  Focal adhesion
hsa04611  Platelet activation
hsa04670  Leukocyte transendothelial migration
hsa04720  Long-term potentiation
hsa04722  Neurotrophin signaling pathway
hsa04934  Cushing's syndrome
hsa04972  Pancreatic secretion
hsa05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5908 (RAP1B)
   04015 Rap1 signaling pathway
    5908 (RAP1B)
   04010 MAPK signaling pathway
    5908 (RAP1B)
   04024 cAMP signaling pathway
    5908 (RAP1B)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    5908 (RAP1B)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5908 (RAP1B)
   04670 Leukocyte transendothelial migration
    5908 (RAP1B)
   04062 Chemokine signaling pathway
    5908 (RAP1B)
  Digestive system
   04972 Pancreatic secretion
    5908 (RAP1B)
  Nervous system
   04720 Long-term potentiation
    5908 (RAP1B)
   04722 Neurotrophin signaling pathway
    5908 (RAP1B)
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    5908 (RAP1B)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    5908 (RAP1B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5908 (RAP1B)
  Exosomal proteins of other body fluids (saliva and urine)
   5908 (RAP1B)
  Exosomal proteins of colorectal cancer cells
   5908 (RAP1B)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Ras Family
   Rap [OT]
    5908 (RAP1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase G-alpha
Motif
Other DBs
NCBI-GeneID: 5908
NCBI-ProteinID: NP_001010942
OMIM: 179530
HGNC: 9857
Ensembl: ENSG00000127314
Vega: OTTHUMG00000133660
Pharos: P61224(Tbio)
UniProt: P61224 A0A024RB87
Structure
PDB: 

Position
12q15
AA seq 184 aa AA seqDB search
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG
TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL
EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS
CQLL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagtataagctagtcgttcttggctcaggaggcgttggaaagtctgctttgact
gtacaatttgttcaaggaatttttgtagaaaaatacgatcctacgatagaagattcttat
agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga
acggagcaatttacagcaatgagggatttatacatgaaaaatggacaaggatttgcatta
gtttattccatcacagcacagtccacatttaacgatttacaagacctgagagaacagatt
cttcgagttaaagacactgatgatgttccaatgattcttgttggtaataagtgtgacttg
gaagatgaaagagttgtagggaaggaacaaggtcaaaatctagcaagacaatggaacaac
tgtgcattcttagaatcttctgcaaaatcaaaaataaatgttaatgagatcttttatgac
ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggctcgcaaaaagtcatca
tgtcagctgctttaa

DBGET integrated database retrieval system