KEGG   Homo sapiens (human): 5912Help
Entry
5912              CDS       T01001                                 

Gene name
RAP2B
Definition
(RefSeq) RAP2B, member of RAS oncogene family
  KO
K07838  Ras-related protein Rap-2B
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5912 (RAP2B)
   04031 GTP-binding proteins [BR:hsa04031]
    5912 (RAP2B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   5912 (RAP2B)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Ras Family
   Rap [OT]
    5912 (RAP2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 MMR_HSR1_Xtn FeoB_N MeaB
Motif
Other DBs
NCBI-GeneID: 5912
NCBI-ProteinID: NP_002877
OMIM: 179541
HGNC: 9862
Ensembl: ENSG00000181467
Vega: OTTHUMG00000159655
Pharos: P61225(Tbio)
UniProt: P61225
Position
3q25.2
AA seq 183 aa AA seqDB search
MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAG
TEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDL
EGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSAC
VIL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagagagtacaaagtggtggtgctgggctcgggcggcgtgggcaagtccgcgctcacc
gtgcagttcgtgacgggctccttcatcgagaagtacgacccgaccatcgaagacttttac
cgcaaggagattgaggtggactcgtcgccgtcggtgctggagatcctggatacggcgggc
accgagcagttcgcgtccatgcgggacctgtacatcaagaacggccagggcttcatcctg
gtctacagcctcgtcaaccagcagagcttccaggacatcaagcccatgcgggaccagatc
atccgcgtgaagcggtacgagcgcgtgcccatgatcctggtgggcaacaaggtggacctg
gagggtgagcgcgaggtctcgtacggggagggcaaggccctggctgaggagtggagctgc
cccttcatggagacgtcggccaaaaacaaagcctcggtagacgagctatttgccgagatc
gtgcggcagatgaactacgcggcgcagcccaacggcgatgagggctgctgctcggcctgc
gtgatcctctga

DBGET integrated database retrieval system