KEGG   Homo sapiens (human): 6280Help
Entry
6280              CDS       T01001                                 

Gene name
S100A9, 60B8AG, CAGB, CFAG, CGLB, L1AG, LIAG, MAC387, MIF, MRP14, NIF, P14
Definition
(RefSeq) S100 calcium binding protein A9
  KO
K21128  protein S100-A9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6280 (S100A9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: S_100 EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_4 LMP EF-hand_6 SPARC_Ca_bdg DUF1451
Motif
Other DBs
NCBI-GeneID: 6280
NCBI-ProteinID: NP_002956
OMIM: 123886
HGNC: 10499
Ensembl: ENSG00000163220
Vega: OTTHUMG00000013125
Pharos: P06702(Tbio)
UniProt: P06702
Structure
PDB: 

Position
1q21.3
AA seq 114 aa AA seqDB search
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIE
HIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgacttgcaaaatgtcgcagctggaacgcaacatagagaccatcatcaacaccttccac
caatactctgtgaagctggggcacccagacaccctgaaccagggggaattcaaagagctg
gtgcgaaaagatctgcaaaattttctcaagaaggagaataagaatgaaaaggtcatagaa
cacatcatggaggacctggacacaaatgcagacaagcagctgagcttcgaggagttcatc
atgctgatggcgaggctaacctgggcctcccacgagaagatgcacgagggtgacgagggc
cctggccaccaccataagccaggcctcggggagggcaccccctaa

DBGET integrated database retrieval system