KEGG   Homo sapiens (human): 6714Help
Entry
6714              CDS       T01001                                 

Gene name
SRC, ASV, SRC1, THC6, c-SRC, p60-Src
Definition
(RefSeq) SRC proto-oncogene, non-receptor tyrosine kinase
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa04012  ErbB signaling pathway
hsa04015  Rap1 signaling pathway
hsa04062  Chemokine signaling pathway
hsa04137  Mitophagy - animal
hsa04144  Endocytosis
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04530  Tight junction
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04625  C-type lectin receptor signaling pathway
hsa04727  GABAergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04810  Regulation of actin cytoskeleton
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04917  Prolactin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04926  Relaxin signaling pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05219  Bladder cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
N00267  HBV HBx to host-cell-protein activation
N00393  ITGA/B-RhoA signaling pathway
N00394  HCMV gH to ITGA/B-RhoA signaling pathway
Disease
H00978  Thrombocytopenia (THC)
Drug target
Bosutinib (DG00718): D03252 D09728
Dasatinib (DG00714): D03658 D06414
Ilorasertib: D10423
Saracatinib (DG01418): D09664 D09665
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    6714 (SRC)
   04012 ErbB signaling pathway
    6714 (SRC)
   04370 VEGF signaling pathway
    6714 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    6714 (SRC)
   04137 Mitophagy - animal
    6714 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    6714 (SRC)
   04520 Adherens junction
    6714 (SRC)
   04530 Tight junction
    6714 (SRC)
   04540 Gap junction
    6714 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    6714 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    6714 (SRC)
   04625 C-type lectin receptor signaling pathway
    6714 (SRC)
   04062 Chemokine signaling pathway
    6714 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    6714 (SRC)
   04915 Estrogen signaling pathway
    6714 (SRC)
   04917 Prolactin signaling pathway
    6714 (SRC)
   04921 Oxytocin signaling pathway
    6714 (SRC)
   04926 Relaxin signaling pathway
    6714 (SRC)
   04919 Thyroid hormone signaling pathway
    6714 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    6714 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    6714 (SRC)
  09158 Development
   04360 Axon guidance
    6714 (SRC)
 09160 Human Diseases
  09161 Cancers
   05205 Proteoglycans in cancer
    6714 (SRC)
   05203 Viral carcinogenesis
    6714 (SRC)
   05219 Bladder cancer
    6714 (SRC)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    6714 (SRC)
  09167 Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6714 (SRC)
   05131 Shigellosis
    6714 (SRC)
   05152 Tuberculosis
    6714 (SRC)
   05100 Bacterial invasion of epithelial cells
    6714 (SRC)
   05161 Hepatitis B
    6714 (SRC)
   05163 Human cytomegalovirus infection
    6714 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    6714 (SRC)
  09168 Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    6714 (SRC)
   01522 Endocrine resistance
    6714 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6714 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6714 (SRC)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     6714 (SRC)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SRC family
   6714 (SRC)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    6714 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    6714 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    6714 (SRC)
  Macropinocytosis
   Kinases
    6714 (SRC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase SH3_3 hSH3
Motif
Other DBs
NCBI-GeneID: 6714
NCBI-ProteinID: NP_005408
OMIM: 190090
HGNC: 11283
Ensembl: ENSG00000197122
Vega: OTTHUMG00000032417
Pharos: P12931(Tclin)
UniProt: P12931
Structure
PDB: 

Position
20q11.23
AA seq 536 aa AA seqDB search
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcaacaagagcaagcccaaggatgccagccagcggcgccgcagcctggagccc
gccgagaacgtgcacggcgctggcgggggcgctttccccgcctcgcagacccccagcaag
ccagcctcggccgacggccaccgcggccccagcgcggccttcgcccccgcggccgccgag
cccaagctgttcggaggcttcaactcctcggacaccgtcacctccccgcagagggcgggc
ccgctggccggtggagtgaccacctttgtggccctctatgactatgagtctaggacggag
acagacctgtccttcaagaaaggcgagcggctccagattgtcaacaacacagagggagac
tggtggctggcccactcgctcagcacaggacagacaggctacatccccagcaactacgtg
gcgccctccgactccatccaggctgaggagtggtattttggcaagatcaccagacgggag
tcagagcggttactgctcaatgcagagaacccgagagggaccttcctcgtgcgagaaagt
gagaccacgaaaggtgcctactgcctctcagtgtctgacttcgacaacgccaagggcctc
aacgtgaagcactacaagatccgcaagctggacagcggcggcttctacatcacctcccgc
acccagttcaacagcctgcagcagctggtggcctactactccaaacacgccgatggcctg
tgccaccgcctcaccaccgtgtgccccacgtccaagccgcagactcagggcctggccaag
gatgcctgggagatccctcgggagtcgctgcggctggaggtcaagctgggccagggctgc
tttggcgaggtgtggatggggacctggaacggtaccaccagggtggccatcaaaaccctg
aagcctggcacgatgtctccagaggccttcctgcaggaggcccaggtcatgaagaagctg
aggcatgagaagctggtgcagttgtatgctgtggtttcagaggagcccatttacatcgtc
acggagtacatgagcaaggggagtttgctggactttctcaagggggagacaggcaagtac
ctgcggctgcctcagctggtggacatggctgctcagatcgcctcaggcatggcgtacgtg
gagcggatgaactacgtccaccgggaccttcgtgcagccaacatcctggtgggagagaac
ctggtgtgcaaagtggccgactttgggctggctcggctcattgaagacaatgagtacacg
gcgcggcaaggtgccaaattccccatcaagtggacggctccagaagctgccctctatggc
cgcttcaccatcaagtcggacgtgtggtccttcgggatcctgctgactgagctcaccaca
aagggacgggtgccctaccctgggatggtgaaccgcgaggtgctggaccaggtggagcgg
ggctaccggatgccctgcccgccggagtgtcccgagtccctgcacgacctcatgtgccag
tgctggcggaaggagcctgaggagcggcccaccttcgagtacctgcaggccttcctggag
gactacttcacgtccaccgagccccagtaccagcccggggagaacctctag

DBGET integrated database retrieval system