KEGG   Homo sapiens (human): 6885Help
Entry
6885              CDS       T01001                                 

Gene name
MAP3K7, CSCF, FMD2, MEKK7, TAK1, TGF1a
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 7
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04140  Autophagy - animal
hsa04152  AMPK signaling pathway
hsa04310  Wnt signaling pathway
hsa04380  Osteoclast differentiation
hsa04520  Adherens junction
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04668  TNF signaling pathway
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05162  Measles
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00686  Toll-like receptor signaling
hsa_M00688  MAPK (JNK) signaling
hsa_M00689  MAPK (p38) signaling
Network
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    6885 (MAP3K7)
   04310 Wnt signaling pathway
    6885 (MAP3K7)
   04064 NF-kappa B signaling pathway
    6885 (MAP3K7)
   04668 TNF signaling pathway
    6885 (MAP3K7)
   04152 AMPK signaling pathway
    6885 (MAP3K7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    6885 (MAP3K7)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    6885 (MAP3K7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6885 (MAP3K7)
   04621 NOD-like receptor signaling pathway
    6885 (MAP3K7)
   04622 RIG-I-like receptor signaling pathway
    6885 (MAP3K7)
   04660 T cell receptor signaling pathway
    6885 (MAP3K7)
   04657 IL-17 signaling pathway
    6885 (MAP3K7)
  09158 Development
   04380 Osteoclast differentiation
    6885 (MAP3K7)
 09160 Human Diseases
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    6885 (MAP3K7)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    6885 (MAP3K7)
   05162 Measles
    6885 (MAP3K7)
   05168 Herpes simplex infection
    6885 (MAP3K7)
   05169 Epstein-Barr virus infection
    6885 (MAP3K7)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    6885 (MAP3K7)
   05140 Leishmaniasis
    6885 (MAP3K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6885 (MAP3K7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     6885 (MAP3K7)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  MLK family
   6885 (MAP3K7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH Mnd1
Motif
Other DBs
NCBI-GeneID: 6885
NCBI-ProteinID: NP_663304
OMIM: 602614
HGNC: 6859
Ensembl: ENSG00000135341
Vega: OTTHUMG00000015217
Pharos: O43318(Tchem)
UniProt: O43318
Structure
PDB: 

Position
6q15
AA seq 606 aa AA seqDB search
MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGN
ILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHP
WTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEI
ALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQ
KRQGTS
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtctacagcctctgccgcctcctcctcctcctcgtcttcggccggtgagatgatcgaa
gccccttcccaggtcctcaactttgaagagatcgactacaaggagatcgaggtggaagag
gttgttggaagaggagcctttggagttgtttgcaaagctaagtggagagcaaaagatgtt
gctattaaacaaatagaaagtgaatctgagaggaaagcgtttattgtagagcttcggcag
ttatcccgtgtgaaccatcctaatattgtaaagctttatggagcctgcttgaatccagtg
tgtcttgtgatggaatatgctgaagggggctctttatataatgtgctgcatggtgctgaa
ccattgccatattatactgctgcccacgcaatgagttggtgtttacagtgttcccaagga
gtggcttatcttcacagcatgcaacccaaagcgctaattcacagggacctgaaaccacca
aacttactgctggttgcaggggggacagttctaaaaatttgtgattttggtacagcctgt
gacattcagacacacatgaccaataacaaggggagtgctgcttggatggcacctgaagtt
tttgaaggtagtaattacagtgaaaaatgtgacgtcttcagctggggtattattctttgg
gaagtgataacgcgtcggaaaccctttgatgagattggtggcccagctttccgaatcatg
tgggctgttcataatggtactcgaccaccactgataaaaaatttacctaagcccattgag
agcctgatgactcgttgttggtctaaagatccttcccagcgcccttcaatggaggaaatt
gtgaaaataatgactcacttgatgcggtactttccaggagcagatgagccattacagtat
ccttgtcagtattcagatgaaggacagagcaactctgccaccagtacaggctcattcatg
gacattgcttctacaaatacgagtaacaaaagtgacactaatatggagcaagttcctgcc
acaaatgatactattaagcgcttagaatcaaaattgttgaaaaatcaggcaaagcaacag
agtgaatctggacgtttaagcttgggagcctcccgtgggagcagtgtggagagcttgccc
ccaacctctgagggcaagaggatgagtgctgacatgtctgaaatagaagctaggatcgcc
gcaaccacagcctattccaagcctaaacggggccaccgtaaaactgcttcatttggcaac
attctggatgtccctgagatcgtcatatcaggcaacggacagccaagacgtagatccatc
caagacttgactgtaactggaacagaacctggtcaggtgagcagtaggtcatccagtccc
agtgtcagaatgattactacctcaggaccaacctcagaaaagccaactcgaagtcatcca
tggacccctgatgattccacagataccaatggatcagataactccatcccaatggcttat
cttacactggatcaccaactacagcctctagcaccgtgcccaaactccaaagaatctatg
gcagtgtttgaacagcattgtaaaatggcacaagaatatatgaaagttcaaacagaaatt
gcattgttattacagagaaagcaagaactagttgcagaactggaccaggatgaaaaggac
cagcaaaatacatctcgcctggtacaggaacataaaaagcttttagatgaaaacaaaagc
ctttctacttactaccagcaatgcaaaaaacaactagaggtcatcagaagtcagcagcag
aaacgacaaggcacttcatga

DBGET integrated database retrieval system