KEGG   Homo sapiens (human): 6885Help
Entry
6885              CDS       T01001                                 

Gene name
MAP3K7, CSCF, FMD2, MEKK7, TAK1, TGF1a
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 7
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04140  Autophagy - animal
hsa04152  AMPK signaling pathway
hsa04310  Wnt signaling pathway
hsa04380  Osteoclast differentiation
hsa04520  Adherens junction
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04668  TNF signaling pathway
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05162  Measles
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00686  Toll-like receptor signaling
hsa_M00688  MAPK (JNK) signaling
hsa_M00689  MAPK (p38) signaling
Network
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    6885 (MAP3K7)
   04310 Wnt signaling pathway
    6885 (MAP3K7)
   04064 NF-kappa B signaling pathway
    6885 (MAP3K7)
   04668 TNF signaling pathway
    6885 (MAP3K7)
   04152 AMPK signaling pathway
    6885 (MAP3K7)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    6885 (MAP3K7)
  Cellular community - eukaryotes
   04520 Adherens junction
    6885 (MAP3K7)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    6885 (MAP3K7)
   04621 NOD-like receptor signaling pathway
    6885 (MAP3K7)
   04622 RIG-I-like receptor signaling pathway
    6885 (MAP3K7)
   04660 T cell receptor signaling pathway
    6885 (MAP3K7)
   04657 IL-17 signaling pathway
    6885 (MAP3K7)
  Development
   04380 Osteoclast differentiation
    6885 (MAP3K7)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    6885 (MAP3K7)
  Infectious diseases
   05162 Measles
    6885 (MAP3K7)
   05168 Herpes simplex infection
    6885 (MAP3K7)
   05169 Epstein-Barr virus infection
    6885 (MAP3K7)
   05145 Toxoplasmosis
    6885 (MAP3K7)
   05140 Leishmaniasis
    6885 (MAP3K7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     6885 (MAP3K7)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  MLK family
   6885 (MAP3K7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH Mnd1
Motif
Other DBs
NCBI-GeneID: 6885
NCBI-ProteinID: NP_663304
OMIM: 602614
HGNC: 6859
Ensembl: ENSG00000135341
Vega: OTTHUMG00000015217
Pharos: O43318(Tchem)
UniProt: O43318
Structure
PDB: 

Position
6q15
AA seq 606 aa AA seqDB search
MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGN
ILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHP
WTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEI
ALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQ
KRQGTS
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtctacagcctctgccgcctcctcctcctcctcgtcttcggccggtgagatgatcgaa
gccccttcccaggtcctcaactttgaagagatcgactacaaggagatcgaggtggaagag
gttgttggaagaggagcctttggagttgtttgcaaagctaagtggagagcaaaagatgtt
gctattaaacaaatagaaagtgaatctgagaggaaagcgtttattgtagagcttcggcag
ttatcccgtgtgaaccatcctaatattgtaaagctttatggagcctgcttgaatccagtg
tgtcttgtgatggaatatgctgaagggggctctttatataatgtgctgcatggtgctgaa
ccattgccatattatactgctgcccacgcaatgagttggtgtttacagtgttcccaagga
gtggcttatcttcacagcatgcaacccaaagcgctaattcacagggacctgaaaccacca
aacttactgctggttgcaggggggacagttctaaaaatttgtgattttggtacagcctgt
gacattcagacacacatgaccaataacaaggggagtgctgcttggatggcacctgaagtt
tttgaaggtagtaattacagtgaaaaatgtgacgtcttcagctggggtattattctttgg
gaagtgataacgcgtcggaaaccctttgatgagattggtggcccagctttccgaatcatg
tgggctgttcataatggtactcgaccaccactgataaaaaatttacctaagcccattgag
agcctgatgactcgttgttggtctaaagatccttcccagcgcccttcaatggaggaaatt
gtgaaaataatgactcacttgatgcggtactttccaggagcagatgagccattacagtat
ccttgtcagtattcagatgaaggacagagcaactctgccaccagtacaggctcattcatg
gacattgcttctacaaatacgagtaacaaaagtgacactaatatggagcaagttcctgcc
acaaatgatactattaagcgcttagaatcaaaattgttgaaaaatcaggcaaagcaacag
agtgaatctggacgtttaagcttgggagcctcccgtgggagcagtgtggagagcttgccc
ccaacctctgagggcaagaggatgagtgctgacatgtctgaaatagaagctaggatcgcc
gcaaccacagcctattccaagcctaaacggggccaccgtaaaactgcttcatttggcaac
attctggatgtccctgagatcgtcatatcaggcaacggacagccaagacgtagatccatc
caagacttgactgtaactggaacagaacctggtcaggtgagcagtaggtcatccagtccc
agtgtcagaatgattactacctcaggaccaacctcagaaaagccaactcgaagtcatcca
tggacccctgatgattccacagataccaatggatcagataactccatcccaatggcttat
cttacactggatcaccaactacagcctctagcaccgtgcccaaactccaaagaatctatg
gcagtgtttgaacagcattgtaaaatggcacaagaatatatgaaagttcaaacagaaatt
gcattgttattacagagaaagcaagaactagttgcagaactggaccaggatgaaaaggac
cagcaaaatacatctcgcctggtacaggaacataaaaagcttttagatgaaaacaaaagc
ctttctacttactaccagcaatgcaaaaaacaactagaggtcatcagaagtcagcagcag
aaacgacaaggcacttcatga

DBGET integrated database retrieval system