KEGG   Homo sapiens (human): 715Help
Entry
715               CDS       T01001                                 

Gene name
C1R, EDSPD1
Definition
(RefSeq) complement C1r
  KO
K01330  complement component 1, r subcomponent [EC:3.4.21.41]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04610  Complement and coagulation cascades
hsa05133  Pertussis
hsa05150  Staphylococcus aureus infection
hsa05322  Systemic lupus erythematosus
Disease
H00102  Classic complement pathway component defects
H02240  Ehlers-Danlos syndrome periodontal type
Drug target
Conestat alfa: D10845
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    715 (C1R)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    715 (C1R)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    715 (C1R)
  09171 Infectious disease: bacterial
   05133 Pertussis
    715 (C1R)
   05150 Staphylococcus aureus infection
    715 (C1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    715 (C1R)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    715 (C1R)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.41  complement subcomponent C_overbar_1r_
     715 (C1R)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   715 (C1R)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    715 (C1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition cEGF EGF_CA EGF hEGF Trypsin_2
Motif
Other DBs
NCBI-GeneID: 715
NCBI-ProteinID: NP_001724
OMIM: 613785
HGNC: 1246
Ensembl: ENSG00000159403
Vega: OTTHUMG00000168149
Pharos: P00736(Tclin)
UniProt: P00736
Structure
PDB: 

Position
12p13.31
AA seq 705 aa AA seqDB search
MWLLYLLVPALFCRAGGSIPIPQKLFGEVTSPLFPKPYPNNFETTTVITVPTGYRVKLVF
QQFDLEPSEGCFYDYVKISADKKSLGRFCGQLGSPLGNPPGKKEFMSQGNKMLLTFHTDF
SNEENGTIMFYKGFLAYYQAVDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGY
ELQEDRHSCQAECSSELYTEASGYISSLEYPRSYPPDLRCNYSIRVERGLTLHLKFLEPF
DIDDHQQVHCPYDQLQIYANGKNIGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKL
RYTTEIIKCPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIEGNQVLHSFTAVCQD
DGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTRAGSR
ESEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQVF
TNIHGRGGGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRV
SVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVME
EKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAV
RDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEEED
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcttgtacctcctggtgccggccctgttctgcagggcaggaggctccattccc
atccctcagaagttatttggggaggtgacttcccctctgttccccaagccttaccccaac
aactttgaaacaaccactgtgatcacagtccccacgggatacagggtgaagctcgtcttc
cagcagtttgacctggagccttctgaaggctgcttctatgattatgtcaagatctctgct
gataagaaaagcctggggaggttctgtgggcaactgggttctccactgggcaaccccccg
ggaaagaaggaatttatgtcccaagggaacaagatgctgctgaccttccacacagacttc
tccaacgaggagaatgggaccatcatgttctacaagggcttcctggcctactaccaagct
gtggaccttgatgaatgtgcttcccggagcaaatcaggggaggaggatccccagccccag
tgccagcacctgtgtcacaactacgttggaggctacttctgttcctgccgtccaggctat
gagcttcaggaagacaggcattcctgccaggctgagtgcagcagcgagctgtacacggag
gcatcaggctacatctccagcctggagtaccctcggtcctacccccctgacctgcgctgc
aactacagcatccgggtggagcggggcctcaccctgcacctcaagttcctggagcctttt
gatattgatgaccaccagcaagtacactgcccctatgaccagctacagatctatgccaac
gggaagaacattggcgagttctgtgggaagcaaaggccccccgacctcgacaccagcagc
aatgctgtggatctgctgttcttcacagatgagtcgggggacagccggggctggaagctg
cgctacaccaccgagatcatcaagtgcccccagcccaagaccctagacgagttcaccatc
atccagaacctgcagcctcagtaccagttccgtgactacttcattgctacctgcaagcaa
ggctaccagctcatagaggggaaccaggtgctgcattccttcacagctgtctgccaggat
gatggcacgtggcatcgtgccatgcccagatgcaagatcaaggactgtgggcagccccga
aacctgcctaatggtgacttccgttacaccaccacaatgggagtgaacacctacaaggcc
cgtatccagtactactgccatgagccatattacaagatgcagaccagagctggcagcagg
gagtctgagcaaggggtgtacacctgcacagcacagggcatttggaagaatgaacagaag
ggagagaagattcctcggtgcttgccagtgtgtgggaagcccgtgaaccccgtggaacag
aggcagcgcatcatcggagggcaaaaagccaagatgggcaacttcccctggcaggtgttc
accaacatccacgggcgcgggggcggggccctgctgggcgaccgctggatcctcacagct
gcccacaccctgtatcccaaggaacacgaagcgcaaagcaacgcctctttggatgtgttc
ctgggccacacaaatgtggaagagctcatgaagctaggaaatcaccccatccgcagggtc
agcgtccacccggactaccgtcaggatgagtcctacaattttgagggggacatcgccctg
ctggagctggaaaatagtgtcaccctgggtcccaacctcctccccatctgcctccctgac
aacgataccttctacgacctgggcttgatgggctatgtcagtggcttcggggtcatggag
gagaagattgctcatgacctcaggtttgtccgtctgcccgtagctaatccacaggcctgt
gagaactggctccggggaaagaataggatggatgtgttctctcaaaacatgttctgtgct
ggacacccatctctaaagcaggacgcctgccagggggatagtgggggcgtttttgcagta
agggacccgaacactgatcgctgggtggccacgggcatcgtgtcctggggcatcgggtgc
agcaggggctatggcttctacaccaaagtgctcaactacgtggactggatcaagaaagag
atggaggaggaggactga

DBGET integrated database retrieval system