KEGG   Homo sapiens (human): 7222
Entry
7222              CDS       T01001                                 

Gene name
TRPC3, SCA41, TRP3
Definition
(RefSeq) transient receptor potential cation channel subfamily C member 3
  KO
K04966  transient receptor potential cation channel subfamily C member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa05017  Spinocerebellar ataxia
Network
nt06410  Calcium signaling
nt06462  Spinocerebellar ataxia
nt06463  Parkinson disease
  Element
N00953  mGluR1-TRPC3 signaling pathway
N00955  Mutation-inactivated PRKCG to mGluR1-TRPC3 signaling pathway
N00956  Mutation-activated PRKCG to mGluR1-TRPC3 signaling pathway
N00961  Mutation-activated TRPC3 to mGluR1-TRPC3 signaling pathway
Disease
H00063  Spinocerebellar ataxia (SCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    7222 (TRPC3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    7222 (TRPC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    7222 (TRPC3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   7222 (TRPC3)
SSDB
Motif
Pfam: Ion_trans TRP_2 PKD_channel Ank_2 Ank_4 PBC MFS_4
Other DBs
NCBI-GeneID: 7222
NCBI-ProteinID: NP_003296
OMIM: 602345
HGNC: 12335
Ensembl: ENSG00000138741
Vega: OTTHUMG00000133069
Pharos: Q13507(Tchem)
UniProt: Q13507
Structure
PDB: 
6CUD 6D7L 5ZBG 6DJS

Position
4q27
AA seq 848 aa
MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYGNIPVVRKMLE
ESKTLNVNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVEA
ILNHPGFAASKRLTLSPCEQELQDDDFYAYDEDGTRFSPDITPIILAAHCQKYEVVHMLL
MKGARIERPHDYFCKCGDCMEKQRHDSFSHSRSRINAYKGLASPAYLSLSSEDPVLTALE
LSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCRDSEEVEAILNGDLESAEPLEVH
RHKASLSRVKLAIKYEVKKFVAHPNCQQQLLTIWYENLSGLREQTIAIKCLVVLVVALGL
PFLAIGYWIAPCSRLGKILRSPFMKFVAHAASFIIFLGLLVFNASDRFEGITTLPNITVT
DYPKQIFRVKTTQFTWTEMLIMVWVLGMMWSECKELWLEGPREYILQLWNVLDFGMLSIF
IAAFTARFLAFLQATKAQQYVDSYVQESDLSEVTLPPEIQYFTYARDKWLPSDPQIISEG
LYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVLFIMVFFAFMIGMFILYS
YYLGAKVNAAFTTVEESFKTLFWSIFGLSEVTSVVLKYDHKFIENIGYVLYGIYNVTMVV
VLLNMLIAMINSSYQEIEDDSDVEWKFARSKLWLSYFDDGKTLPPPFSLVPSPKSFVYFI
MRIVNFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRVFESHSFNSILNQPTRYQQIMK
RLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQATEELAILIHKLSEKL
NPSMLRCE
NT seq 2547 nt   +upstreamnt  +downstreamnt
atggagggaagcccatccctgagacgcatgacagtgatgcgggagaagggccggcgccag
gctgtcaggggcccggccttcatgttcaatgaccgcggcaccagcctcaccgccgaggag
gagcgcttcctcgacgccgccgagtacggcaacatcccagtggtgcgcaagatgctggag
gagtccaagacgctgaacgtcaactgcgtggactacatgggccagaacgcgctgcagctg
gctgtgggcaacgagcacctggaggtgaccgagctgctgctcaagaaggagaacctggcg
cgcattggcgacgccctgctgctcgccatcagcaagggctacgtgcgcatcgtagaggcc
atcctcaaccaccctggcttcgcggccagcaagcgtctcactctgagcccctgtgagcag
gagctgcaggacgacgacttctacgcttacgacgaggacggcacgcgcttctcgccggac
atcacccccatcatcctggcggcgcactgccagaaatacgaagtggtgcacatgctgctg
atgaagggtgccaggatcgagcggccgcacgactatttctgcaagtgcggggactgcatg
gagaagcagaggcacgactccttcagccactcacgctcgaggatcaatgcctacaagggg
ctggccagcccggcttacctctcattgtccagcgaggacccggtgcttacggccctagag
ctcagcaacgagctggccaagctggccaacatagagaaggagttcaagaatgactatcgg
aagctctccatgcaatgcaaagactttgtagtgggtgtgctggatctctgccgagactca
gaagaggtagaagccattctgaatggagatctggaatcagcagagcctctggaggtacac
aggcacaaagcttcattaagtcgtgtcaaacttgccattaagtatgaagtcaaaaagttt
gtggctcatcccaactgccagcagcagctcttgacgatctggtatgagaacctctcaggc
ctaagggagcagaccatagctatcaagtgtctcgttgtgctggtcgtggccctgggcctt
ccattcctggccattggctactggatcgcaccttgcagcaggctggggaaaattctgcga
agcccttttatgaagtttgtagcacatgcagcttctttcatcatcttcctgggtctgctt
gtgttcaatgcctcagacaggttcgaaggcatcaccacgctgcccaatatcacagttact
gactatcccaaacagatcttcagggtgaaaaccacccagtttacatggactgaaatgcta
attatggtctgggttcttggaatgatgtggtctgaatgtaaagagctctggctggaagga
cctagggaatacattttgcagttgtggaatgtgcttgactttgggatgctgtccatcttc
attgctgctttcacagccagattcctagctttccttcaggcaacgaaggcacaacagtat
gtggacagttacgtccaagagagtgacctcagtgaagtgacactcccaccagagatacag
tatttcacttatgctagagataaatggctcccttctgaccctcagattatatctgaaggc
ctttatgccatagctgttgtgctcagcttctctcggattgcgtacatcctccctgcaaat
gagagctttggccccctgcagatctctcttggaaggactgtaaaggacatattcaagttc
atggtcctctttattatggtgttttttgcctttatgattggcatgttcatactttattct
tactaccttggggctaaagttaatgctgcttttaccactgtagaagaaagtttcaagact
ttattttggtcaatatttgggttgtctgaagtgacttccgttgtgctcaaatatgatcac
aaattcatagaaaatattggatacgttctttatggaatatacaatgtaactatggtggtc
gttttactcaacatgctaattgctatgattaatagctcatatcaagaaattgaggatgac
agtgatgtagaatggaagtttgctcgttcaaaactttggttatcctattttgatgatgga
aaaacattacctccacctttcagtctagttcctagtccaaaatcatttgtttatttcatc
atgcgaattgttaactttcccaaatgcagaaggagaaggcttcagaaggatatagaaatg
ggaatgggtaactcaaagtccaggttaaacctcttcactcagtctaactcaagagttttt
gaatcacacagttttaacagcattctcaatcagccaacacgttatcagcagataatgaaa
agacttataaagcggtatgttttgaaagcacaagtagacaaagaaaatgatgaagttaat
gaaggtgaattaaaagaaatcaagcaagatatctccagccttcgttatgaacttttggaa
gacaagagccaagcaactgaggaattagccattctaattcataaacttagtgagaaactg
aatcccagcatgctgagatgtgaatga

DBGET integrated database retrieval system