KEGG   Homo sapiens (human): 7225Help
Entry
7225              CDS       T01001                                 

Gene name
TRPC6, FSGS2, TRP6
Definition
(RefSeq) transient receptor potential cation channel subfamily C member 6
  KO
K04969  transient receptor potential cation channel subfamily C member 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04360  Axon guidance
Disease
H00626  Focal segmental glomerulosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP - PKG signaling pathway
    7225 (TRPC6)
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    7225 (TRPC6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    7225 (TRPC6)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   7225 (TRPC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans TRP_2 PKD_channel Ank_2 Ank_4 Ank_5 ING CBFB_NFYA
Motif
Other DBs
NCBI-GeneID: 7225
NCBI-ProteinID: NP_004612
OMIM: 603652
HGNC: 12338
Ensembl: ENSG00000137672
Vega: OTTHUMG00000167483
Pharos: Q9Y210(Tchem)
UniProt: Q9Y210
Structure
PDB: 

Position
11q22.1
AA seq 931 aa AA seqDB search
MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPCYGYYPCFRGS
DNRLAHRRQTVLREKGRRLANRGPAYMFSDRSTSLSIEEERFLDAAEYGNIPVVRKMLEE
CHSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLSRVGDALLLAISKGYVRIVEAI
LSHPAFAEGKRLATSPSQSELQQDDFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHTLLR
KGARIERPHDYFCKCNDCNQKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALEL
SNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVETLQSGDHGR
PNLSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTMAVKFLVVLAVAIGLPFL
ALIYWFAPCSKMGKIMRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKLLPNETSTDNA
KQLFRMKTSCFSWMEMLIISWVIGMIWAECKEIWTQGPKEYLFELWNMLDFGMLAIFAAS
FIARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQIISEGLYA
IAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYI
GAKQNEAFTTVEESFKTLFWAIFGLSEVKSVVINYNHKFIENIGYVLYGVYNVTMVIVLL
NMLIAMINSSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPSPKSLFYLLLKL
KKWISELFQGHKKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSS
EDFHLNSFNNPPRQYQKIMKRLIKRYVLQAQIDKESDEVNEGELKEIKQDISSLRYELLE
EKSQNTEDLAELIRELGEKLSMEPNQEETNR
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgagccagagcccggcgttcgggccccggaggggcagttctccccggggcgctgccgga
gccgctgcgcggcgcaacgagagccaggactatctgctcatggactcggagctgggagaa
gacggctgcccgcaagccccgctgccttgctacggctactacccctgcttccggggatct
gacaacagactggctcaccggcggcagacagttctccgtgagaaggggagaaggttagct
aatcgaggaccagcatacatgtttagtgatcgctccacaagcctatctatagaggaggaa
cgctttttggatgcagctgaatatggtaacatcccagtggtgcggaagatgttagaagaa
tgccactcactcaacgttaactgtgtggattacatgggccagaatgccctacagttggca
gtggccaatgagcatctggaaattacagaacttcttctcaagaaagaaaacctctctcga
gttggggatgctttgcttctagctattagtaaaggttatgttcggattgtggaagcaatt
ctcagtcatccggcttttgctgaaggcaagaggttagcaaccagccctagccagtctgaa
ctccagcaagatgatttttatgcctatgatgaagatgggacacggttctcccatgatgtg
actccaatcattctggctgcccactgccaggaatatgaaattgtgcataccctcctgcgg
aagggtgctaggattgaacggcctcatgattatttctgcaagtgcaatgactgcaaccag
aaacagaagcatgactcgtttagccactccagatctaggattaatgcctataaaggcctg
gcaagtccggcttacctgtcattgtctagtgaagatccagtcatgacggctttagaactt
agcaatgaactggcagttctggccaatattgagaaagagttcaagaatgactacaaaaaa
ctgtcaatgcagtgcaaagactttgttgttggactccttgatctgtgcagaaacactgaa
gaagtcgaggccattctgaatggggatgttgaaacgctccagagtggtgatcacggtcgc
ccaaatctcagccgtttaaaacttgccattaaatatgaagtaaaaaaatttgtagctcat
ccaaactgccaacagcaacttctctccatttggtatgagaatctttctggtttacgacag
cagacaatggcggtcaagttccttgtggtccttgctgttgccattggactgcccttcctg
gctctcatttactggtttgctccatgcagcaagatggggaagataatgcgtggaccattc
atgaagtttgtagcacacgcagcctccttcaccatttttctgggactgctagtcatgaat
gcagctgacagatttgaaggcacaaaactccttcctaatgaaaccagcacagataatgca
aaacagctgttcaggatgaaaacatcctgcttctcatggatggagatgctcattatatcc
tgggtaataggcatgatatgggctgaatgtaaagaaatctggactcagggccccaaggaa
tatttgtttgagttgtggaacatgcttgattttggtatgttagcaattttcgcagcatca
ttcattgcgagattcatggcattttggcatgcttccaaagcccagagcatcattgacgca
aatgatactttgaaggacttgacgaaagtaacattgggagacaatgtgaaatactacaat
ttggccaggataaagtgggacccctctgatcctcaaataatatctgaaggtctttatgca
attgctgtagttttaagtttctctaggatagcttatattttaccagcaaatgaaagcttt
ggacctctgcagatatcacttggaagaacagtcaaagacatcttcaagttcatggtcata
ttcattatggtgtttgtggcctttatgattggaatgttcaatctctactcctactacatt
ggtgcaaaacaaaatgaagccttcacaacagttgaagagagttttaagacactgttctgg
gctatatttggactttctgaagtgaaatcagtggtcatcaactataaccacaaattcatt
gaaaacattggttacgttctttatggagtctataatgttacgatggtcattgttttgcta
aatatgttaattgccatgatcaacagttcattccaggaaattgaggatgacgctgatgtg
gagtggaaatttgcaagggccaaactctggttttcctactttgaggagggcagaacactt
cctgtacccttcaatctggtgccgagtccaaagtccctgttttatctcttactgaagctt
aaaaaatggatttctgagctgttccagggccataaaaaaggtttccaggaagatgcagag
atgaacaagataaatgaagaaaagaaacttggaattttaggaagtcatgaagacctttca
aaattatcacttgacaaaaaacaggttgggcacaataaacaaccaagtataaggagctca
gaagatttccatctaaatagtttcaataatcctccaagacaatatcagaaaataatgaaa
aggctcattaaaagatatgtactgcaggcccagatagataaggagagtgatgaagtgaac
gaaggggaactgaaggaaattaagcaggacatctcaagtctccgctatgaactccttgaa
gaaaaatctcagaatacagaagacctagcagaacttattagagaacttggagagaaatta
tccatggaaccaaatcaagaggaaaccaatagataa

DBGET integrated database retrieval system