KEGG   Homo sapiens (human): 7373Help
Entry
7373              CDS       T01001                                 

Gene name
COL14A1, UND
Definition
(RefSeq) collagen type XIV alpha 1 chain
  KO
K08133  collagen, type XIV, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Disease
H01404  Punctate palmoplantar keratoderma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    7373 (COL14A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    7373 (COL14A1)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Collagen family
   7373 (COL14A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWA fn3 Collagen VWA_2 Pur_ac_phosph_N VWA_3 Arylsulfotran_N CBM_4_9
Motif
Other DBs
NCBI-GeneID: 7373
NCBI-ProteinID: NP_066933
OMIM: 120324
HGNC: 2191
Ensembl: ENSG00000187955
Vega: OTTHUMG00000149877
Pharos: Q05707(Tbio)
UniProt: Q05707
Position
8q24.12
AA seq 1796 aa AA seqDB search
MKIFQRKMRYWLLPPFLAIVYFCTIVQGQVAPPTRLRYNVISHDSIQISWKAPRGKFGGY
KLLVTPTSGGKTNQLNLQNTATKAIIQGLMPDQNYTVQIIAYNKDKESKPAQGQFRIKDL
EKRKDPKPRVKVVDRGNGSRPSSPEEVKFVCQTPAIADIVILVDGSWSIGRFNFRLVRHF
LENLVTAFDVGSEKTRIGLAQYSGDPRIEWHLNAFSTKDEVIEAVRNLPYKGGNTLTGLA
LNYIFENSFKPEAGSRTGVSKIGILITDGKSQDDIIPPSRNLRESGVELFAIGVKNADVN
ELQEIASEPDSTHVYNVAEFDLMHTVVESLTRTLCSRVEEQDREIKASAHAITGPPTELI
TSEVTARSFMVNWTHAPGNVEKYRVVYYPTRGGKPDEVVVDGTVSSTVLKNLMSLTEYQI
AVFAIYAHTASEGLRGTETTLALPMASDLLLYDVTENSMRVKWDAVPGASGYLILYAPLT
EGLAGDEKEMKIGETHTDIELSGLLPNTEYTVTVYAMFGEEASDPVTGQETTLALSPPRN
LRISNVGSNSARLTWDPTSRQINGYRIVYNNADGTEINEVEVDPITTFPLKGLTPLTEYT
IAIFSIYDEGQSEPLTGVFTTEEVPAQQYLEIDEVTTDSFRVTWHPLSADEGLHKLMWIP
VYGGKTEEVVLKEEQDSHVIEGLEPGTEYEVSLLAVLDDGSESEVVTAVGTTLDSFWTEP
ATTIVPTTSVTSVFQTGIRNLVVGDETTSSLRVKWDISDSDVQQFRVTYMTAQGDPEEEV
IGTVMVPGSQNNLLLKPLLPDTEYKVTVTPIYTDGEGVSVSAPGKTLPSSGPQNLRVSEE
WYNRLRITWDPPSSPVKGYRIVYKPVSVPGPTLETFVGADINTILITNLLSGMDYNVKIF
ASQASGFSDALTGMVKTLFLGVTNLQAKHVEMTSLCAHWQVHRHATAYRVVIESLQDRQK
QESTVGGGTTRHCFYGLQPDSEYKISVYTKLQEIEGPSVSIMEKTQSLPTRPPTFPPTIP
PAKEVCKAAKADLVFMVDGSWSIGDENFNKIISFLYSTVGALNKIGTDGTQVAMVQFTDD
PRTEFKLNAYKTKETLLDAIKHISYKGGNTKTGKAIKYVRDTLFTAESGTRRGIPKVIVV
ITDGRSQDDVNKISREMQLDGYSIFAIGVADADYSELVSIGSKPSARHVFFVDDFDAFKK
IEDELITFVCETASATCPVVHKDGIDLAGFKMMEMFGLVEKDFSSVEGVSMEPGTFNVFP
CYQLHKDALVSQPTRYLHPEGLPSDYTISFLFRILPDTPQEPFALWEILNKNSDPLVGVI
LDNGGKTLTYFNYDQSGDFQTVTFEGPEIRKIFYGSFHKLHIVVSETLVKVVIDCKQVGE
KAMNASANITSDGVEVLGKMVRSRGPGGNSAPFQLQMFDIVCSTSWANTDKCCELPGLRD
DESCPDLPHSCSCSETNEVALGPAGPPGGPGLRGPKGQQGEPGPKGPDGPRGEIGLPGPQ
GPPGPQGPSGLSIQGMPGMPGEKGEKGDTGLPGPQGIPGGVGSPGRDGSPGQRGLPGKDG
SSGPPGPPGPIGIPGTPGVPGITGSMGPQGALGPPGVPGAKGERGERGDLQSQAMVRSVA
RQVCEQLIQSHMARYTAILNQIPSHSSSIRTVQGPPGEPGRPGSPGAPGEQGPPGTPGFP
GNAGVPGTPGERGLTGIKGEKGNPGVGTQGPRGPPGPAGPSGESRPGSPGPPGSPGPRGP
PGHLGVPGPQGPSGQPGYCDPSSCSAYGVRAPHPDQPEFTPVQDELEAMELWGPGV
NT seq 5391 nt NT seq  +upstreamnt  +downstreamnt
atgaagattttccagcgcaagatgcggtactggttgcttccaccttttttggcaattgtt
tatttctgcaccattgtccaaggtcaagtggctccacccacaaggttaagatataatgta
atatctcatgacagtatacagatttcatggaaggctccaagagggaaatttggtggttac
aaacttcttgtgactccaacttcaggtggaaaaactaaccagctgaatctgcagaacact
gcaactaaagcaattattcaaggccttatgccagaccagaattacacagttcaaattatt
gcatacaataaagataaagaaagcaagccagctcaaggccaattcagaattaaagattta
gaaaaaagaaaggatccaaagcccagagtcaaagttgtggacagaggaaatgggagtaga
ccatcttcaccagaagaagtgaaatttgtctgtcaaactccagcaattgctgacattgta
atcctggtcgatggttcatggagtattggaagattcaacttcagactggttcggcatttc
ttggaaaacctggttacagcattcgatgtgggctcagagaagacacgaattggtcttgca
cagtatagtggtgaccccagaatagaatggcacttgaatgcatttagcacaaaagatgaa
gtgattgaagctgtccgaaacctcccatataaaggaggaaatacactaacaggtcttgct
ttgaactacatttttgaaaatagcttcaaaccagaagcaggatcaaggactggagtatcc
aaaattggcattttaatcacagatggaaaatcccaagatgacattattccaccatctaga
aatcttcgtgagtctggtgtagaactgtttgccataggggtgaaaaacgcggatgtgaat
gagctgcaggagatcgcctctgaaccagacagcactcatgtgtacaatgttgccgaattc
gatctgatgcacacagttgtggagagtctgaccaggactctctgctctagagtggaagaa
caggacagagaaattaaagcctcagcccatgccatcactgggccgcctacggagttgatt
acttctgaagtcactgccagaagctttatggttaactggactcatgccccaggaaatgtg
gaaaaatacagagttgtgtattatcctaccaggggtggaaaaccagacgaggtggtggta
gatggaactgtatcttccacagtgttgaaaaacttgatgtctttaactgaatatcagata
gcagtctttgcaatctatgcccacactgctagtgaaggcctacggggaactgaaactaca
cttgctttaccgatggcttctgaccttctactgtacgacgtgactgagaacagcatgcga
gtcaaatgggatgcagtgcctggggcctcaggttacctgatcctttatgctcctctaaca
gagggcctggctggggatgaaaaagagatgaaaattggagagacccacacagatattgaa
ttgagtgggttgttgcccaatacagaatacacagtcacagtttatgccatgtttggagaa
gaggccagtgatcctgttacgggacaagaaacaacattggctttaagtccaccaagaaac
ctgagaatctccaatgttggctctaacagtgctcgattaacctgggacccaacttcaaga
cagatcaatggttatcgaattgtatataacaatgcagatgggactgaaatcaatgaggtt
gaagtcgatcctattactaccttccctctgaagggcttgacacctctcacagagtatact
attgctattttctccatctatgatgaaggacagtcagagcctctgactggagtttttacc
accgaggaagttccagcccagcaatacttagaaattgatgaggtgacgacagacagtttt
agggtgacctggcatcccctctcagctgatgaagggctacacaaattgatgtggattcca
gtctatggggggaagactgaggaggttgtcctgaaagaagagcaggactcacatgttatt
gaaggcctggagcccggtacggagtatgaagtttcactattggccgtacttgatgatgga
agcgagagtgaggtggtgactgctgtcgggaccacacttgacagtttttggacagaacca
gctacaaccatagtgcctaccacatctgtgacttcagttttccagacgggaatcagaaac
ctagttgtaggtgatgaaactacttctagcctgcgggtaaaatgggacatttctgacagc
gatgtgcagcagtttagggtgacctacatgacagctcaaggggaccctgaggaagaagtc
ataggaacggttatggtgcctggaagccagaacaacctccttctgaagcctctgcttcct
gatactgaatacaaagtcacagtgactcccatctacacggatggcgaaggcgtcagcgtc
tccgctcctggaaaaaccttaccatcctcggggccccagaacttgcgggtgtccgaggaa
tggtataaccggttgcgcattacgtgggaccccccatcttccccggtgaaaggctataga
attgtctacaaacctgtcagtgttcctggtccaacactggaaacgtttgtgggagctgac
attaacaccatccttatcacaaacctcctcagcggaatggactacaatgtgaagatattt
gcctcccaggcctcaggcttcagcgacgccctgacaggcatggtgaaaacattgttcttg
ggtgttaccaatctccaagccaaacatgttgaaatgaccagcttgtgtgcccactggcag
gtacatcgccatgccacagcctatagggttgttatagaatccctccaggataggcaaaag
caagaatccactgtgggtggagggacaaccaggcattgcttctatggacttcagcctgat
tctgaatataaaatcagtgtttatacaaagctccaggagattgaaggacctagtgtgagc
ataatggaaaaaacacaatcacttcctacacgaccaccaacttttcctccaaccattcca
ccagcaaaagaagtatgtaaggcggccaaggctgacctggtatttatggtggatggatcc
tggagcattggagatgaaaatttcaataagatcatcagctttctatacagcactgttgga
gccctgaacaagattggcacagatggaacccaagttgcaatggttcagttcactgatgat
cccagaacagaatttaaactaaatgcttacaaaaccaaagagactcttcttgatgcaatt
aaacacatttcatacaaaggaggaaatacaaaaacaggaaaagcaattaagtatgttcga
gataccttgttcactgcagagtcaggtacaagaaggggcatcccaaaggttatcgtggtt
ataactgatggaagatcacaagatgatgtgaacaaaatctccagggagatgcaattagat
ggctatagcatttttgcaattggtgtggccgatgcagattactcggagttggttagcatt
ggcagtaagcccagcgcacgccatgtcttctttgtggatgactttgacgcctttaagaaa
atcgaagatgagttaattacttttgtctgcgaaacagcatcagcaacctgtccagtggta
cacaaggatggcattgatcttgcaggatttaagatgatggaaatgtttggtttggttgaa
aaagatttttcatcagtggaaggggtttctatggagcctggtaccttcaatgtgtttcca
tgttaccaactccataaagatgccctggtttcccagccaaccaggtacttgcacccagaa
ggattgccctccgactacacaatcagttttctattccggattcttcctgacactccacag
gagccatttgctctttgggagattttaaataaaaattctgacccattggttggggttatt
ttagacaatggtgggaaaactctaacatatttcaactatgaccagagtggggattttcaa
actgttactttcgaaggacctgaaattaggaaaattttttatggaagctttcacaagcta
cacattgttgtcagtgagactttggtcaaagtggttattgactgcaagcaagtgggtgag
aaggcaatgaacgcatcagctaatatcacgtcagatggtgtagaagtgctagggaaaatg
gttcgatcaagaggaccaggtggaaactctgcaccgttccagttacagatgtttgatatt
gtttgctccacatcatgggccaatacagacaaatgctgtgaacttccaggcctgagagat
gatgagtcttgcccagaccttccccattcctgctcctgttctgaaaccaatgaagtggct
ctgggaccagcgggcccaccaggtggtccaggactccgaggaccaaagggccagcaaggt
gaaccgggtccaaagggaccagatggccctcggggtgaaattggtctgccaggacctcag
ggtccacctggacctcaaggaccaagtggtctgtccattcaaggaatgcccggaatgcca
ggagaaaaaggagagaaaggagatactggccttccaggtccacagggtatcccaggaggc
gttggttcaccaggacgtgatggctcaccaggccagaggggccttccgggaaaggatgga
tcctcgggacctccaggaccaccagggccaataggcattcctggcacccctggagtccca
gggatcacaggaagcatgggaccgcaaggcgccctgggaccacctggtgtccctggagca
aagggggaacgaggagagcggggtgacctgcagtctcaagccatggtgagatcagtggcg
cgtcaagtatgcgaacagctcatccagagtcacatggccaggtacactgccatcctcaac
cagattcccagccactcctcatccatccggactgtccaagggcctcctggggagcctggg
aggccaggctcacctggagcccctggtgaacaaggacccccaggcacaccaggcttcccc
ggaaatgcaggcgtgccagggaccccaggagaacgaggtctaactggtatcaaaggagaa
aaaggaaatccaggcgttggaacccaaggtccaagaggcccccctggaccagcaggacct
tcaggggagagtcggcctggcagccctgggccccctggctctcctggaccaagaggccca
ccaggtcatctgggggttcctggaccccaaggtccttctggccagcctggatattgtgac
ccctcatcatgttctgcctatggtgtgagagctccccatccagatcagccagagttcacc
cctgtccaagatgagctggaagccatggaactgtggggccctggagtctga

DBGET integrated database retrieval system