KEGG   Homo sapiens (human): 80325
Entry
80325             CDS       T01001                                 
Symbol
ABTB1, BPOZ, BTB3, BTBD21, EF1ABP, PP2259
Name
(RefSeq) ankyrin repeat and BTB domain containing 1
  KO
K10520  ankyrin repeat and BTB/POZ domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    80325 (ABTB1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     80325 (ABTB1)
SSDB
Motif
Pfam: BTB Ank_2 Ank_4 Ank_5 Ank_3 BACK Ank
Other DBs
NCBI-GeneID: 80325
NCBI-ProteinID: NP_742024
OMIM: 608308
HGNC: 18275
Ensembl: ENSG00000114626
Pharos: Q969K4(Tbio)
UniProt: Q969K4
Position
3:127672952..127680926
AA seq 478 aa
MDTSDLFASCRKGDVGRVRYLLEQRDVEVNVRDKWDSTPLYYACLCGHEELVLYLLANGA
RCEANTFDGERCLYGALSDPIRRALRDYKQVTASCRRRDYYDDFLQRLLEQGIHSDVVFV
VHGKPFRVHRCVLGARSAYFANMLDTKWKGKSVVVLRHPLINPVAFGALLQYLYTGRLDI
GVEHVSDCERLAKQCQLWDLLSDLEAKCEKVSEFVASKPGTCVKVLTIEPPPADPRLRED
MALLADCALPPELRGDLWELPFPCPDGFNSCPDICFRVAGCSFLCHKAFFCGRSDYFRAL
LDDHFRESEEPATSGGPPAVTLHGISPDVFTHVLYYMYSDHTELSPEAAYDVLSVADMYL
LPGLKRLCGRSLAQMLDEDTVVGVWRVAKLFRLARLEDQCTEYMAKVIEKLVEREDFVEA
VKEEAAAVAARQETDSIPLVDDIRFHVASTVQTYSAIEEAQQRLRALEDLLVSIGLDC
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggacaccagcgacctgttcgccagctgcaggaagggggatgtgggccgagtgcggtac
ctgctggagcagcgagacgtggaggtgaatgtgcgggacaagtgggacagcacccccttg
tactatgcctgcttgtgtgggcacgaggagctggtactctaccttctggccaatggagcc
cgctgcgaggccaacaccttcgatggtgagcgctgcctctatggggcactgagtgacccc
atccgccgggctctacgcgattacaagcaggtcacggcttcctgcaggaggcgggattac
tatgacgacttcttgcagcggcttctagagcagggcatccacagtgacgtggtctttgta
gtacacgggaagccattccgggtgcatcgctgcgtcctgggtgcacgtagtgcctacttt
gccaacatgctggacaccaaatggaagggcaagagtgtcgtggttctcaggcacccactg
atcaaccccgtggcctttggggccctgctgcagtacctgtacacaggccgcctggacatt
ggcgtagagcatgtgagtgactgtgagcgcctggccaagcaatgccagctgtgggacctg
ctcagcgacctggaggccaagtgcgagaaggtgtctgagtttgtggcgtctaagccaggc
acgtgtgtgaaggtgctgaccatcgagcccccacctgcagacccccgcctccgggaggac
atggcgctgctggccgattgtgccctgccccccgagctccgaggtgatctttgggagctg
cccttcccttgtcctgacggcttcaacagctgccctgacatctgcttccgagtggctggc
tgcagcttcctctgccacaaggcctttttctgtggccgcagtgactacttccgagccctg
ctggatgaccacttccgagagagcgaggagccagcgacctcagggggccccccagccgtc
accctgcatggcatctcacccgacgtcttcactcacgtgctctactacatgtacagcgac
cacactgagctgtcccccgaggcagcctatgatgtgctgagcgtcgccgacatgtacctg
ctgccaggcctgaagaggctgtgcggccgcagcctggctcagatgctagacgaggacact
gtggtgggtgtgtggcgcgtggccaagctcttccgcctggcgcggcttgaggaccagtgc
actgagtacatggccaaggtcattgagaagctggtggagcgggaggacttcgtggaggcg
gtgaaggaggaggcagcggctgtggcagcccggcaggagacggactctatcccgctggtg
gacgacatccgcttccacgtggccagcacggtgcagacctacagcgccatagaggaggcg
cagcagcgtctgcgggcactcgaggacctgctcgtgtccatcggtctggactgttga

DBGET integrated database retrieval system