KEGG   Homo sapiens (human): 8038Help
Entry
8038              CDS       T01001                                 

Gene name
ADAM12, ADAM12-OT1, CAR10, MCMP, MCMPMltna, MLTN, MLTNA
Definition
(RefSeq) ADAM metallopeptidase domain 12
  KO
K06835  disintegrin and metalloproteinase domain-containing protein 12 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    8038 (ADAM12)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     8038 (ADAM12)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   8038 (ADAM12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Reprolysin ADAM_CR Pep_M12B_propep Reprolysin_5 Disintegrin Reprolysin_3 Reprolysin_2 Reprolysin_4 Peptidase_M66 Zincin_1
Motif
Other DBs
NCBI-GeneID: 8038
NCBI-ProteinID: NP_003465
OMIM: 602714
HGNC: 190
Ensembl: ENSG00000148848
Vega: OTTHUMG00000019243
Pharos: O43184(Tchem)
UniProt: O43184
Position
10q26.2
AA seq 909 aa AA seqDB search
MAARPLPVSPARALLLALAGALLAPCEARGVSLWNQGRADEVVSASVGSGDLWIPVKSFD
SKNHPEVLNIRLQRESKELIINLERNEGLIASSFTETHYLQDGTDVSLARNYTVILGHCY
YHGHVRGYSDSAVSLSTCSGLRGLIVFENESYVLEPMKSATNRYKLFPAKKLKSVRGSCG
SHHNTPNLAAKNVFPPPSQTWARRHKRETLKATKYVELVIVADNREFQRQGKDLEKVKQR
LIEIANHVDKFYRPLNIRIVLVGVEVWNDMDKCSVSQDPFTSLHEFLDWRKMKLLPRKSH
DNAQLVSGVYFQGTTIGMAPIMSMCTADQSGGIVMDHSDNPLGAAVTLAHELGHNFGMNH
DTLDRGCSCQMAVEKGGCIMNASTGYPFPMVFSSCSRKDLETSLEKGMGVCLFNLPEVRE
SFGGQKCGNRFVEEGEECDCGEPEECMNRCCNATTCTLKPDAVCAHGLCCEDCQLKPAGT
ACRDSSNSCDLPEFCTGASPHCPANVYLHDGHSCQDVDGYCYNGICQTHEQQCVTLWGPG
AKPAPGICFERVNSAGDPYGNCGKVSKSSFAKCEMRDAKCGKIQCQGGASRPVIGTNAVS
IETNIPLQQGGRILCRGTHVYLGDDMPDPGLVLAGTKCADGKICLNRQCQNISVFGVHEC
AMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQADNQGLTIGILVTILCL
LAAGFVVYLKRKTLIRLLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGHLGKGLMRKPP
DSYPPKDNPRRLLQCQNVDISRPLNGLNVPQPQSTQRVLPPLHRAPRAPSVPARPLPAKP
ALRQAQGTCKPNPPQKPLPADPLARTTRLTHALARTPGQWETGLRLAPLRPAPQYPHQVP
RSTHTAYIK
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgcgcccgctgcccgtgtcccccgcccgcgccctcctgctcgccctggccggt
gctctgctcgcgccctgcgaggcccgaggggtgagcttatggaaccaaggaagagctgat
gaagttgtcagtgcctctgttgggagtggggacctctggatcccagtgaagagcttcgac
tccaagaatcatccagaagtgctgaatattcgactacaacgggaaagcaaagaactgatc
ataaatctggaaagaaatgaaggtctcattgccagcagtttcacggaaacccactatctg
caagacggtactgatgtctccctcgctcgaaattacacggtaattctgggtcactgttac
taccatggacatgtacggggatattctgattcagcagtcagtctcagcacgtgttctggt
ctcaggggacttattgtgtttgaaaatgaaagctatgtcttagaaccaatgaaaagtgca
accaacagatacaaactcttcccagcgaagaagctgaaaagcgtccggggatcatgtgga
tcacatcacaacacaccaaacctcgctgcaaagaatgtgtttccaccaccctctcagaca
tgggcaagaaggcataaaagagagaccctcaaggcaactaagtatgtggagctggtgatc
gtggcagacaaccgagagtttcagaggcaaggaaaagatctggaaaaagttaagcagcga
ttaatagagattgctaatcacgttgacaagttttacagaccactgaacattcggatcgtg
ttggtaggcgtggaagtgtggaatgacatggacaaatgctctgtaagtcaggacccattc
accagcctccatgaatttctggactggaggaagatgaagcttctacctcgcaaatcccat
gacaatgcgcagcttgtcagtggggtttatttccaagggaccaccatcggcatggcccca
atcatgagcatgtgcacggcagaccagtctgggggaattgtcatggaccattcagacaat
ccccttggtgcagccgtgaccctggcacatgagctgggccacaatttcgggatgaatcat
gacacactggacaggggctgtagctgtcaaatggcggttgagaaaggaggctgcatcatg
aacgcttccaccgggtacccatttcccatggtgttcagcagttgcagcaggaaggacttg
gagaccagcctggagaaaggaatgggggtgtgcctgtttaacctgccggaagtcagggag
tctttcgggggccagaagtgtgggaacagatttgtggaagaaggagaggagtgtgactgt
ggggagccagaggaatgtatgaatcgctgctgcaatgccaccacctgtaccctgaagccg
gacgctgtgtgcgcacatgggctgtgctgtgaagactgccagctgaagcctgcaggaaca
gcgtgcagggactccagcaactcctgtgacctcccagagttctgcacaggggccagccct
cactgcccagccaacgtgtacctgcacgatgggcactcatgtcaggatgtggacggctac
tgctacaatggcatctgccagactcacgagcagcagtgtgtcacgctctggggaccaggt
gctaaacctgcccctgggatctgctttgagagagtcaattctgcaggtgatccttatggc
aactgtggcaaagtctcgaagagttcctttgccaaatgcgagatgagagatgctaaatgt
ggaaaaatccagtgtcaaggaggtgccagccggccagtcattggtaccaatgccgtttcc
atagaaacaaacatccccctgcagcaaggaggccggattctgtgccgggggacccacgtg
tacttgggcgatgacatgccggacccagggcttgtgcttgcaggcacaaagtgtgcagat
ggaaaaatctgcctgaatcgtcaatgtcaaaatattagtgtctttggggttcacgagtgt
gcaatgcagtgccacggcagaggggtgtgcaacaacaggaagaactgccactgcgaggcc
cactgggcacctcccttctgtgacaagtttggctttggaggaagcacagacagcggcccc
atccggcaagcagataaccaaggtttaaccataggaattctggtgaccatcctgtgtctt
cttgctgccggatttgtggtttatctcaaaaggaagaccttgatacgactgctgtttaca
aataagaagaccaccattgaaaaactaaggtgtgtgcgcccttcccggccaccccgtggc
ttccaaccctgtcaggctcacctcggccaccttggaaaaggcctgatgaggaagccgcca
gattcctacccaccgaaggacaatcccaggagattgctgcagtgtcagaatgttgacatc
agcagacccctcaacggcctgaatgtccctcagccccagtcaactcagcgagtgcttcct
cccctccaccgggctccacgtgcacctagcgtccctgccagacccctgccagccaagcct
gcacttaggcaggcccaggggacctgtaagccaaacccccctcagaagcctctgcctgca
gatcctctggccagaacaactcggctcactcatgccttggccaggaccccaggacaatgg
gagactgggctccgcctggcacccctcagacctgctccacaatatccacaccaagtgccc
agatccacccacaccgcctatattaagtga

DBGET integrated database retrieval system