KEGG   Homo sapiens (human): 815Help
Entry
815               CDS       T01001                                 

Gene name
CAMK2A, CAMKA, MRD53
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II alpha
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04114  Oocyte meiosis
hsa04217  Necroptosis
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04722  Neurotrophin signaling pathway
hsa04725  Cholinergic synapse
hsa04728  Dopaminergic synapse
hsa04740  Olfactory transduction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04916  Melanogenesis
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04934  Cushing's syndrome
hsa04971  Gastric acid secretion
hsa05031  Amphetamine addiction
hsa05152  Tuberculosis
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05214  Glioma
Network
N00026  EGF-EGFR-PLCG-CAMK signaling pathway
N00027  Amplified EGFR to PLCG-CAMK signaling pathway
N00028  PDGF-PDGFR-PLCG-CAMK signaling pathway
N00029  Amplified PDGFR to PLCG-CAMK signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
Disease
H00773  Autosomal dominant mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    815 (CAMK2A)
   04310 Wnt signaling pathway
    815 (CAMK2A)
   04066 HIF-1 signaling pathway
    815 (CAMK2A)
   04020 Calcium signaling pathway
    815 (CAMK2A)
   04024 cAMP signaling pathway
    815 (CAMK2A)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    815 (CAMK2A)
   04217 Necroptosis
    815 (CAMK2A)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    815 (CAMK2A)
   04922 Glucagon signaling pathway
    815 (CAMK2A)
   04912 GnRH signaling pathway
    815 (CAMK2A)
   04921 Oxytocin signaling pathway
    815 (CAMK2A)
   04916 Melanogenesis
    815 (CAMK2A)
   04925 Aldosterone synthesis and secretion
    815 (CAMK2A)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    815 (CAMK2A)
  Digestive system
   04971 Gastric acid secretion
    815 (CAMK2A)
  Nervous system
   04725 Cholinergic synapse
    815 (CAMK2A)
   04728 Dopaminergic synapse
    815 (CAMK2A)
   04720 Long-term potentiation
    815 (CAMK2A)
   04722 Neurotrophin signaling pathway
    815 (CAMK2A)
  Sensory system
   04740 Olfactory transduction
    815 (CAMK2A)
   04750 Inflammatory mediator regulation of TRP channels
    815 (CAMK2A)
  Development
   04360 Axon guidance
    815 (CAMK2A)
  Environmental adaptation
   04713 Circadian entrainment
    815 (CAMK2A)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    815 (CAMK2A)
   05205 Proteoglycans in cancer
    815 (CAMK2A)
   05214 Glioma
    815 (CAMK2A)
  Substance dependence
   05031 Amphetamine addiction
    815 (CAMK2A)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    815 (CAMK2A)
  Infectious diseases
   05152 Tuberculosis
    815 (CAMK2A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     815 (CAMK2A)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   815 (CAMK2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 APH Kdo SnoaL_2 SnoaL_4
Motif
Other DBs
NCBI-GeneID: 815
NCBI-ProteinID: NP_741960
OMIM: 114078
HGNC: 1460
Ensembl: ENSG00000070808
Vega: OTTHUMG00000134281
Pharos: Q9UQM7(Tchem)
UniProt: Q9UQM7 A8K161 Q7LDD5 Q8IWE0
Structure
PDB: 

Position
5q32
AA seq 478 aa AA seqDB search
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEA
ISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIH
LMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggccaccatcacctgcacccgcttcacggaagagtaccagctcttcgaggaattgggc
aagggagccttctcggtggtgcgaaggtgtgtgaaggtgctggctggccaggagtatgct
gccaagatcatcaacacaaagaagctgtcagccagagaccatcagaagctggagcgtgaa
gcccgcatctgccgcctgctgaagcaccccaacatcgtccgactacatgacagcatctca
gaggagggacaccactacctgatcttcgacctggtcactggtggggaactgtttgaagat
atcgtggcccgggagtattacagtgaggcggatgccagtcactgtatccagcagatcctg
gaggctgtgctgcactgccaccagatgggggtggtgcaccgggacctgaagcctgagaat
ctgttgctggcctccaagctcaagggtgccgcagtgaagctggcagactttggcctggcc
atagaggtggagggggagcagcaggcatggtttgggtttgcagggactcctggatatctc
tccccagaagtgctgcggaaggacccgtacgggaagcctgtggacctgtgggcttgtggg
gtcatcctgtacatcctgctggttgggtaccccccgttctgggatgaggaccagcaccgc
ctgtaccagcagatcaaagccggcgcctatgatttcccatcgccggaatgggacactgtc
accccggaagccaaggatctgatcaataagatgctgaccattaacccatccaaacgcatc
acagctgccgaagcccttaagcacccctggatctcgcaccgctccaccgtggcatcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaatgccaggaggaaactgaag
ggagccattctcaccacgatgctggccaccaggaacttctccggagggaagagtggggga
aacaagaagagcgatggtgtgaaggaatcctcagagagcaccaacaccaccatcgaggat
gaagacaccaaagtgcggaaacaggaaattataaaagtgacagagcagctgattgaagcc
ataagcaatggagattttgagtcctacacgaagatgtgcgaccctggcatgacagccttc
gaacctgaggccctggggaacctggttgagggcctggacttccatcgattctattttgaa
aacctgtggtcccggaacagcaagcccgtgcacaccaccatcctgaatccccacatccac
ctgatgggcgacgagtcagcctgcatcgcctacatccgcatcacgcagtacctggacgct
ggcggcatcccacgcaccgcccagtcggaggagacccgtgtctggcaccgccgggatggc
aaatggcagatcgtccacttccacagatctggggcgccctccgtcctgccccactga

DBGET integrated database retrieval system