KEGG   Homo sapiens (human): 8824Help
Entry
8824              CDS       T01001                                 

Gene name
CES2, CE-2, CES2A1, PCE-2, iCE
Definition
(RefSeq) carboxylesterase 2
  KO
K03927  carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    8824 (CES2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     8824 (CES2)
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     8824 (CES2)
    3.1.1.84  cocaine esterase
     8824 (CES2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Peptidase_S9 Say1_Mug180 Esterase
Motif
Other DBs
NCBI-GeneID: 8824
NCBI-ProteinID: NP_003860
OMIM: 605278
HGNC: 1864
Ensembl: ENSG00000172831
Vega: OTTHUMG00000137517
Pharos: O00748(Tchem)
UniProt: O00748
Position
16q22.1
AA seq 559 aa AA seqDB search
MRLHRLRARLSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKGANAGVQTFLG
IPFAKPPLGPLRFAPPEPPESWSGVRDGTTHPAMCLQDLTAVESEFLSQFNMTFPSDSMS
EDCLYLSIYTPAHSHEGSNLPVMVWIHGGALVFGMASLYDGSMLAALENVVVVIIQYRLG
VLGFFSTGDKHATGNWGYLDQVAALRWVQQNIAHFGGNPDRVTIFGESAGGTSVSSLVVS
PISQGLFHGAIMESGVALLPGLIASSADVISTVVANLSACDQVDSEALVGCLRGKSKEEI
LAINKPFKMIPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLIPKVMRIYDTQ
KEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPA
LQVAHFQCSRAPVYFYEFQHQPSWLKNIRPPHMKADHGDELPFVFRSFFGGNYIKFTEEE
EQLSRKMMKYWANFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKK
ALPQKIQELEEPEERHTEL
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgcacagacttcgtgcgcggctgagcgcggtggcctgtgggcttctgctgctt
cttgtccggggccagggccaggactcagccagtcccatccggaccacacacacggggcag
gtgctggggagtcttgtccatgtgaagggcgccaatgccggggtccaaaccttcctggga
attccatttgccaagccacctctaggtccgctgcgatttgcaccccctgagccccctgaa
tcttggagtggtgtgagggatggaaccacccatccggccatgtgtctacaggacctcacc
gcagtggagtcagagtttcttagccagttcaacatgaccttcccttccgactccatgtct
gaggactgcctgtacctcagcatctacacgccggcccatagccatgaaggctctaacctg
ccggtgatggtgtggatccacggtggtgcgcttgtttttggcatggcttccttgtatgat
ggttccatgctggctgccttggagaacgtggtggtggtcatcatccagtaccgcctgggt
gtcctgggcttcttcagcactggagacaagcacgcaaccggcaactggggctacctggac
caagtggctgcactacgctgggtccagcagaatatcgcccactttggaggcaaccctgac
cgtgtcaccatttttggcgagtctgcgggtggcacgagtgtgtcttcgcttgttgtgtcc
cccatatcccaaggactcttccacggagccatcatggagagtggcgtggccctcctgccc
ggcctcattgccagctcagctgatgtcatctccacggtggtggccaacctgtctgcctgt
gaccaagttgactctgaggccctggtgggctgcctgcggggcaagagtaaagaggagatt
cttgcaattaacaagcctttcaagatgatccccggagtggtggatggggtcttcctgccc
aggcacccccaggagctgctggcctctgccgactttcagcctgtccctagcattgttggt
gtcaacaacaatgaattcggctggctcatccccaaggtcatgaggatctatgatacccag
aaggaaatggacagagaggcctcccaggctgctctgcagaaaatgttaacgctgctgatg
ttgcctcctacatttggtgacctgctgagggaggagtacattggggacaatggggatccc
cagaccctccaagcgcagttccaggagatgatggcggactccatgtttgtgatccctgca
ctccaagtagcacattttcagtgttcccgggcccctgtgtacttctacgagttccagcat
cagcccagctggctcaagaacatcaggccaccgcacatgaaggcagaccatggtgatgag
cttccttttgttttcagaagtttctttgggggcaactacattaaattcactgaggaagag
gagcagctaagcaggaagatgatgaagtactgggccaactttgcgagaaatgggaacccc
aatggcgagggtctgccacactggccgctgttcgaccaggaggagcaatacctgcagctg
aacctacagcctgcggtgggccgggctctgaaggcccacaggctccagttctggaagaag
gcgctgccccaaaagatccaggagctcgaggagcctgaagagagacacacagagctgtag

DBGET integrated database retrieval system