KEGG   Homo sapiens (human): 92999
Entry
92999             CDS       T01001                                 
Symbol
ZBTB47, ZNF651
Name
(RefSeq) zinc finger and BTB domain containing 47
  KO
K10518  zinc finger and BTB domain-containing protein 47
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    92999 (ZBTB47)
   04121 Ubiquitin system [BR:hsa04121]
    92999 (ZBTB47)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    92999 (ZBTB47)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     92999 (ZBTB47)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-met zf-C2H2_6 zf-C2H2_jaz KLHL33-like_BTB_POZ zf-Di19 zf-MYST zf-C2H2_8
Other DBs
NCBI-GeneID: 92999
NCBI-ProteinID: NP_660149
OMIM: 619969
HGNC: 26955
Ensembl: ENSG00000114853
UniProt: Q9UFB7
Position
3:42652931..42667580
AA seq 747 aa
MGRLNEQRLFQPDLCDVDLVLVPQRSVFPAHKGVLAAYSQFFHSLFTQNKQLQRVELSLE
ALAPGGLQQILNFIYTSKLLVNAANVHEVLSAASLLQMADIAASCQELLDARSLGPPGPG
TVALAQPAASCTPAAPPYYCDIKQEADTPGLPKIYAREGPDPYSVRVEDGAGTAGGTVPA
TIGPAQPFFKEEKEGGVEEAGGPPASLCKLEGGEELEEELGGSGTYSRREQSQIIVEVNL
NNQTLHVSTGPEGKPGAGPSPATVVLGREDGLQRHSDEEEEDDEEEEEEEEEEEGGGSGR
EEEEEEEGGSQGEEEEEEEDGHSEQEEEEEEEEEEGPSEQDQESSEEEEGEEGEAGGKQG
PRGSRSSRADPPPHSHMATRSRENARRRGTPEPEEAGRRGGKRPKPPPGVASASARGPPA
TDGLGAKVKLEEKQHHPCQKCPRVFNNRWYLEKHMNVTHSRMQICDQCGKRFLLESELLL
HRQTDCERNIQCVTCGKAFKKLWSLHEHNKIVHGYAEKKFSCEICEKKFYTMAHVRKHMV
AHTKDMPFTCETCGKSFKRSMSLKVHSLQHSGEKPFRCENCNERFQYKYQLRSHMSIHIG
HKQFMCQWCGKDFNMKQYFDEHMKTHTGEKPYICEICGKSFTSRPNMKRHRRTHTGEKPY
PCDVCGQRFRFSNMLKAHKEKCFRVSHTLAGDGVPAAPGLPPTQPQAHALPLLPGLPQTL
PPPPHLPPPPPLFPTTASPGGRMNANN
NT seq 2244 nt   +upstreamnt  +downstreamnt
atgggccgcctgaacgagcagcgcctcttccagcctgacctctgcgacgtggacttggtg
ctggtgccccagcgcagcgtctttccggcacacaagggtgtgctagccgcctacagccag
ttcttccactcactcttcacccagaacaagcagctgcagcgtgtggagctgtccctggag
gcactggcacctggtggcctgcagcagatcctcaacttcatctatacgtccaagctgctg
gtcaacgcggccaacgtccacgaggtgctcagcgccgcctcattgctgcagatggctgac
atcgctgcgtcctgccaagagctgctggacgcccgctctctaggcccaccaggtccgggc
actgtggccctggcccagccggctgccagctgcactccagctgcgccgccctactactgt
gacatcaagcaggaggccgacaccccaggcctgcccaagatctatgcccgcgagggccct
gacccttactcggtgcgtgttgaggacggggcagggactgctggtggcacagtgcctgcc
accattgggccagcccagcccttctttaaggaggagaaggagggtggtgtcgaggaggcc
ggtgggcccccagccagcttgtgcaagctggagggtggagaagagttggaggaagagctt
gggggttctggcacctacagccgcagggagcaatcccagatcatcgtggaggtgaacctc
aacaaccagacactgcacgtgtccacggggccagaggggaagccaggtgccgggccaagc
ccagccaccgtggttctgggccgggaggacgggctgcagagacactcggacgaggaggag
gaggacgacgaggaggaggaggaggaagaagaggaagaggaaggtggtggcagtggacgg
gaggaggaggaggaggaagagggtggcagtcagggagaagaggaagaagaggaggaggac
gggcacagtgagcaggaagaggaagaggaggaggaagaggaggaagggcctagtgagcag
gatcaagagagctctgaggaggaggagggggaggagggggaggctgggggcaagcagggg
ccacggggaagccgaagcagccgggcagacccccctccccacagtcacatggccacacgg
tcccgggagaacgcccggcgccggggtacccctgaacctgaagaagctgggcggcggggt
gggaagaggccaaagccaccccctggagtggcctctgcatcggcccgagggccgccagcc
actgatgggctgggggccaaggtgaagctggaggagaagcagcaccatccatgccagaag
tgcccacgagttttcaacaaccgctggtacctggagaaacacatgaatgtgacccacagc
cgcatgcagatctgcgaccagtgcggcaagcgcttcctgctggagagcgagctgctgctg
cacaggcagacagactgcgagcgcaacatccagtgtgtgacatgtggcaaagctttcaag
aagctttggtccctccatgagcataacaagattgtgcacggctacgcagagaagaagttc
tcatgcgagatctgtgagaagaagttctacaccatggcccacgtgcgtaagcacatggtt
gcccacaccaaggacatgcccttcacctgcgagacctgcggaaagtccttcaagcgcagc
atgtccctcaaggtgcactcactgcagcactcaggggagaagccgttcagatgtgagaac
tgcaatgagcgcttccagtacaagtaccagctgcggtcacacatgagcatccacattggc
cacaagcagttcatgtgccaatggtgcggcaaggacttcaacatgaagcagtacttcgat
gagcacatgaagacccacacaggagagaagccgtacatctgcgagatctgtggcaagagc
ttcaccagccggcccaacatgaagcggcaccggcgcacgcacacgggcgagaagccgtac
ccgtgcgacgtgtgtggccagcgcttccgcttctccaacatgctcaaggcccacaaggag
aagtgcttccgcgtcagccacaccctggccggcgacggcgtccccgctgccccaggcctg
cccccaacccagccccaggcgcacgcactgcccctgctcccggggctgccccagaccctg
ccgcccccgccccacctgccgcccccgcctccgctcttccccaccactgccagccccggc
gggaggatgaacgccaacaactag

DBGET integrated database retrieval system