KEGG   Homo sapiens (human): 9630Help
Entry
9630              CDS       T01001                                 

Gene name
GNA14
Definition
(RefSeq) G protein subunit alpha 14
  KO
K04636  guanine nucleotide-binding protein subunit alpha-14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa05142  Chagas disease (American trypanosomiasis)
hsa05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    9630 (GNA14)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    9630 (GNA14)
   05142 Chagas disease (American trypanosomiasis)
    9630 (GNA14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    9630 (GNA14)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    9630 (GNA14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Condensation Atx10homo_assoc GUN4 AAA_24
Motif
Other DBs
NCBI-GeneID: 9630
NCBI-ProteinID: NP_004288
OMIM: 604397
HGNC: 4382
Ensembl: ENSG00000156049
Vega: OTTHUMG00000020058
Pharos: O95837(Tbio)
UniProt: O95837
Position
9q21.2
AA seq 355 aa AA seqDB search
MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHG
SGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSML
SREQVEAIKQLWQDPGIQECYDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRV
PTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDN
ENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVRA
ARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLREFNLV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggccggctgctgctgcctgtccgcggaggagaaggagtcgcagcgcatcagcgcggag
atcgagcgacagcttcgtcgggacaagaaggacgcgcgccgtgagcttaagctgctgctg
ctgggaactggtgaaagtgggaaaagcacctttatcaagcagatgagaattatccatggg
tctggttacagcgacgaagacagaaaggggttcacgaagctggtttaccaaaacatattc
accgccatgcaagccatgatcagagcgatggacacgctaaggatacagtatgtgtgtgaa
cagaataaggaaaatgcccagataatcagagaagtggaagtggacaaggtctccatgctc
tccagggagcaggtggaggccatcaagcagctctggcaagatccaggcatccaggagtgt
tacgacaggaggagggagtaccagctgtcggactctgccaaatattacctgactgacatt
gaccgcatcgccacaccatcattcgtgcctacccaacaagatgtgcttcgcgtccgagtg
cccaccaccggcatcattgagtatccatttgacttggaaaacatcatctttcggatggtg
gatgttggtggccaacgatcggaaagacggaagtggattcactgctttgagagtgtcacc
tccattattttcttggttgctctgagtgaatatgaccaggtcctggctgagtgtgacaac
gagaatcgcatggaagagagcaaagccttatttaaaaccatcatcacctacccctggttt
ctgaattcgtctgtgattttattcttgaacaagaaggatcttttggaagagaaaatcatg
tactctcatctaattagctatttcccagaatacacaggaccgaaacaggatgtcagagct
gccagagactttatcctgaagctttaccaagatcagaatcctgacaaagagaaagtcatc
tactctcacttcacatgtgctacagatacagacaatattcgctttgtgtttgctgctgtc
aaagacacaattctacagctaaacctaagggaattcaaccttgtctaa

DBGET integrated database retrieval system